KEGG   Lactococcus lactis subsp. lactis KF147: LLKF_1168Help
Entry
LLKF_1168         CDS       T01141                                 

Gene name
ylfH
Definition
(GenBank) Hydrolase, HAD superfamily
  KO
K01101  4-nitrophenyl phosphatase [EC:3.1.3.41]
Organism
llk  Lactococcus lactis subsp. lactis KF147
Pathway
llk00627  Aminobenzoate degradation
llk01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:llk00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    LLKF_1168 (ylfH)
Enzymes [BR:llk01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.41  4-nitrophenylphosphatase
     LLKF_1168 (ylfH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hydrolase_6 Hydrolase_like HAD_2 Hydrolase
Motif
Other DBs
NCBI-ProteinID: ADA64869
UniProt: D2BQP4
Position
1182262..1183035
Genome map
AA seq 257 aa AA seqDB search
MTNKKYGGYLIDLDGTIYLGNKRIPAGENFIHRLQEAKIPYLLVTNNTTKTPRVVQRRLS
QQFNIDTPLETIYTASLATVDYMNDLGLEKTVYIIGEDGLKEAIYEAGYKKDRENPAYVV
VALDTDLTYEMLVLATLAIHKGAKFIGTNPDLNLPNERGLTPGAGALIKMLEAATRVEAT
IIGKPEAIIANKAVEKLGLPKSDLLMVGDNYLTDIHTGINNGIDSLLVTTGFTRAEEVPN
LPVPPTYVVASLDEWEV
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgacaaataaaaaatatggtggttacttaattgaccttgatgggacaatttacttggga
aataagcgtattcctgcaggcgagaatttcattcatcggctacaagaggctaaaatacct
tatcttttggtcacaaataacacaacaaaaacaccgcgcgtggtacaacgccgtttgagt
caacaatttaatattgacactccattggaaacgatttatactgcaagtcttgctactgtt
gattatatgaatgatttaggcttagaaaaaacagtttatatcattggagaagatggtctt
aaagaagcgatttatgaggcaggttacaaaaaagatcgtgagaatccagcttacgttgtg
gtcgctttagatactgatttaacttatgaaatgcttgtccttgctactctggcaattcat
aaaggagctaaatttatcggaacaaatccagatttgaatttgccaaacgaacgtggtttg
actcctggagctggagcgctgataaaaatgcttgaagcggcaacacgagttgaagcaacc
attattggtaagccagaagctattatagccaataaagcggtcgaaaaattagggcttcct
aaatctgatttattaatggttggcgacaattatctgacagatattcatacgggcattaat
aacggaattgatagcttgcttgtcacaactggatttacaagagctgaagaagtaccaaat
cttccagttcctccgacttatgtagtagctagtttagatgagtgggaagtttga

DBGET integrated database retrieval system