KEGG   Lactococcus lactis subsp. lactis KF147: LLKF_1250Help
Entry
LLKF_1250         CDS       T01141                                 

Gene name
hisD
Definition
(GenBank) Histidinol dehydrogenase
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
llk  Lactococcus lactis subsp. lactis KF147
Pathway
llk00340  Histidine metabolism
llk01100  Metabolic pathways
llk01110  Biosynthesis of secondary metabolites
llk01230  Biosynthesis of amino acids
Module
llk_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:llk00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    LLKF_1250 (hisD)
Enzymes [BR:llk01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     LLKF_1250 (hisD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histidinol_dh Med11 Grg1
Motif
Other DBs
NCBI-ProteinID: ADA64935
UniProt: D2BQW0
Position
1301294..1302589
Genome map
AA seq 431 aa AA seqDB search
MLKQIDYQGKLEEIAEKFQGRKTEVSKEVNKTVQQIVADIQKNGDTALFNYAKKFDGYDV
NTSNLLVTRMEREAGLEQIDEDYFRILRRTKSQIEEFHKHQLGNSWNIFKENGVIMGQIA
RPLERVALYVPGGTAAYPSTVIMNAVPALLAGVKEIIMITPVKADGKVNPNILAAAEVCG
IETIYKVGGAQGVAAVAYGTESIPKVDKIVGPGNIFVATAKKICYGVVDIDMIAGPSEVL
VIADKTAKPKYIAADLMAQAEHDKLASAILVTTSEKLVQQVDEELNRQVQNLERREIIES
SIRNYGGAIVVKNIDEAFDVSNQLAPEHLEVLTSEPLTQLPKIKNAGSIFIGEYTPEPLG
DYMSGSNHVLPTGGTAKFYSGLGVYNFIKYLTYSYYPKEVLADFKEDVETFAKSEGLTAH
ANSISVRFDEM
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atgctcaaacaaattgattatcaaggaaagcttgaagaaattgctgaaaaatttcaaggt
cgaaaaacagaagtatcaaaagaagttaataaaactgttcaacagattgtagcagacatt
caaaaaaatggagatactgccttatttaactatgccaaaaagttcgacggttatgatgtg
aatactagtaatttactggtcacgcgcatggaacgtgaagcaggactagaacaaattgat
gaggattattttagaattcttagacgcaccaaatcacaaatcgaagaatttcataagcac
caactgggaaattcatggaatatttttaaggaaaatggtgttatcatgggacaaattgcg
cgtcctctggaacgtgttgctctctatgttcccggaggaacggctgcatatccctcaaca
gtcattatgaatgctgttccagcgcttttagcaggcgtcaaagaaattattatgattact
ccagttaaagctgatggaaaagtaaatccaaatattttagcagctgctgaagtttgtgga
atagaaacaatctataaggtgggtggagcacaaggcgttgctgccgttgcgtatgggaca
gaatctattcccaaagttgataagattgtcggacccggaaatatttttgtggctacagct
aagaaaatctgttatggggtggtagatattgatatgatagccggtccgtcagaagttcta
gttattgctgacaaaactgccaagccaaaatatatcgctgctgatttaatggcgcaagca
gaacatgataaacttgcgtcagcgattctagtgacgacttctgaaaaacttgttcaacaa
gtagatgaggaattaaatagacaagttcaaaatttggaacgtcgtgaaatcattgaaagt
tccatcaggaattacggtggagccattgttgtaaaaaatattgatgaagcctttgatgtt
tccaatcagctggctccagaacatttagaagttttgactagtgaacctttaacccaactt
ccaaaaatcaaaaatgctggctcaatttttattggagagtatacgccagaaccgttaggc
gactatatgtcaggaagcaatcatgtcttaccaactggaggaacagccaaattttactct
ggtttgggtgtttataattttataaaatatttgacttatagctattatcctaaagaagtt
ttggctgactttaaagaggatgttgagacatttgcaaaatcagaaggattgacggctcat
gctaactcaatttctgtgagatttgatgaaatgtaa

DBGET integrated database retrieval system