KEGG   Lactococcus lactis subsp. lactis KF147: LLKF_1956Help
Entry
LLKF_1956         CDS       T01141                                 

Gene name
fadA
Definition
(GenBank) Acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
llk  Lactococcus lactis subsp. lactis KF147
Pathway
llk00071  Fatty acid degradation
llk00072  Synthesis and degradation of ketone bodies
llk00280  Valine, leucine and isoleucine degradation
llk00362  Benzoate degradation
llk00380  Tryptophan metabolism
llk00620  Pyruvate metabolism
llk00630  Glyoxylate and dicarboxylate metabolism
llk00640  Propanoate metabolism
llk00650  Butanoate metabolism
llk00900  Terpenoid backbone biosynthesis
llk01100  Metabolic pathways
llk01110  Biosynthesis of secondary metabolites
llk01120  Microbial metabolism in diverse environments
llk01130  Biosynthesis of antibiotics
llk01200  Carbon metabolism
llk01212  Fatty acid metabolism
llk02020  Two-component system
Brite
KEGG Orthology (KO) [BR:llk00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    LLKF_1956 (fadA)
   00630 Glyoxylate and dicarboxylate metabolism
    LLKF_1956 (fadA)
   00640 Propanoate metabolism
    LLKF_1956 (fadA)
   00650 Butanoate metabolism
    LLKF_1956 (fadA)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    LLKF_1956 (fadA)
   00072 Synthesis and degradation of ketone bodies
    LLKF_1956 (fadA)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    LLKF_1956 (fadA)
   00310 Lysine degradation
    LLKF_1956 (fadA)
   00380 Tryptophan metabolism
    LLKF_1956 (fadA)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    LLKF_1956 (fadA)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    LLKF_1956 (fadA)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    LLKF_1956 (fadA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:llk04147]
    LLKF_1956 (fadA)
Enzymes [BR:llk01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     LLKF_1956 (fadA)
Exosome [BR:llk04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   LLKF_1956 (fadA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ADA65531
UniProt: D2BL75
Position
2019570..2020718
Genome map
AA seq 382 aa AA seqDB search
MSFKNPVGIIAANRLPIGKINGFYKKISPETLYQNLIKQQFNKNPLLKKADIDYIILGNV
TNQGGNLARRCALKAGFSSQVPAFTIDQQCGSGLTAMISSANYIISGEASIICTGGVEST
SQANIVLDSESYQPINRFKMAPEPYEDFDMGTIADMTALKYNIPRSVQDLYALNSHKKAT
QAIEGKLLENEVFPYQDEGFTISSDQTVRPKSSMEALSKLTPAFTTNGTATAGNSCPIND
GASSIILSSTNNPFDFQGYYLGQTTVALSPSDFLLGPIKATEKLLQKFSLKLNDIEAIEL
NEAFASQAILFQNYFKLDGTKLNAYGGALAFGHPYGATGGILISRLLNRLNQVQKPCLGI
ATLCVAGGMGISVLIGNHWYQK
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgagctttaaaaatcccgtcggtatcatagcagcaaaccgtttacctataggaaaaatc
aatggtttttataaaaaaatttctcctgaaactttatatcaaaatctaattaaacaacag
tttaataaaaatccacttctcaaaaaagctgatattgactatattattttgggaaatgtg
actaatcaaggaggaaatttagctcgacgttgtgccttaaaagcaggattttctagccag
gtcccagcttttacaattgaccagcagtgcggttctggactgacagctatgattagctct
gcaaactacattatttctggcgaagcttccattatttgtacaggaggggtagaaagcaca
tctcaagccaatattgtgcttgattcagagagttatcagccgattaaccgatttaaaatg
gctcctgaaccctatgaagatttcgacatgggaacaattgccgatatgacagccctaaaa
tacaatattcctcgtagtgttcaagacctttacgctctaaatagtcataaaaaagcgact
caagctattgaaggaaaacttttagaaaatgaagtttttccctatcaagatgaaggattt
acaataagtagcgatcaaactgttcgccctaaatcctcaatggaagccttgagcaaatta
acccctgcttttaccactaacggaacagccactgctggaaactcttgcccaataaacgat
ggtgcttcttcaatcatattgtcatccactaataatccttttgattttcagggctattat
ttaggacaaacaactgttgctttatctccatcagatttcttattaggcccaataaaagca
actgaaaaacttttacagaaatttagccttaaacttaatgatattgaggctatcgaatta
aatgaagcatttgccagtcaggccattttattccaaaattattttaagcttgatggtaca
aaattaaatgcttatggtggtgcccttgcatttggtcatccttacggtgcaactggtggc
attctaatttctcgactcttaaatcgcctaaaccaagtgcaaaagccatgtcttggcatc
gcaactttgtgcgtagctggaggtatgggaatcagtgtactgataggtaatcactggtat
caaaaatga

DBGET integrated database retrieval system