KEGG   Lactococcus lactis subsp. lactis KF147: LLKF_2179Help
Entry
LLKF_2179         CDS       T01141                                 

Gene name
yuhD
Definition
(GenBank) 23S rRNA m(1)G 745 methyltransferase
  KO
K00563  23S rRNA (guanine745-N1)-methyltransferase [EC:2.1.1.187]
Organism
llk  Lactococcus lactis subsp. lactis KF147
Brite
KEGG Orthology (KO) [BR:llk00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:llk03009]
    LLKF_2179 (yuhD)
Enzymes [BR:llk01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.187  23S rRNA (guanine745-N1)-methyltransferase
     LLKF_2179 (yuhD)
Ribosome biogenesis [BR:llk03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    LLKF_2179 (yuhD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methyltransf_11 Methyltransf_25 Methyltransf_23 Methyltransf_31
Motif
Other DBs
NCBI-ProteinID: ADA65753
UniProt: D2BM41
Position
complement(2247370..2248191)
Genome map
AA seq 273 aa AA seqDB search
MLKKIEKAYLLLEENVEMLRCPICHGKFQLAAYALKCENNHTYNLNKKGYVNFLQTKADT
EHYTRKMFEPRRRLIQAGMYQNLLTEIQKSFVSGNLLDVGTGEGSFLELLEGAGAKFAFD
IAKDGIEMATELDTKSFLSLADLTNLPFADESLSVILNIFTPSNYAEFHRVLTENGRVIK
IIPDRNYLRELREVYQLPVDYDNQAVIERFKEEFPKNTQQTIDYTFEIPENLRQDFLLMS
PLEWSVSEERKKFAKENPPKTARIHVQILIGIK
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atgttaaaaaaaattgaaaaagcttatttacttttagaagaaaatgtggaaatgttgaga
tgtccaatttgtcatggaaaatttcaattggcagcctatgccttaaaatgtgaaaataat
catacttataatttaaacaagaaaggttatgttaattttttacaaacaaaagctgacaca
gagcattatacgcgtaaaatgtttgaaccacgtagacgcctaattcaagcagggatgtat
caaaatttactgacagaaattcaaaaatcatttgtcagtggaaatttacttgatgttgga
acaggtgaaggttcatttttagaactcctagagggtgcgggggcgaagtttgcttttgat
attgctaaagatggaattgaaatggcaaccgaattagatacgaaaagttttctgtcctta
gctgatttaactaatctcccttttgctgacgaaagtctgtcagtaattttgaatattttt
acgccttcaaattatgcagaatttcatcgagttctgacagaaaatggccgggtcattaaa
attattcctgacagaaattatttacgtgagttgcgagaagtttatcaacttccagttgat
tatgataatcaagcagttattgagcgttttaaagaagagtttcctaagaatactcaacaa
acaattgattatacttttgaaattccagaaaatttgcgtcaagatttcttattgatgagt
ccattagaatggtcagtttctgaggaaagaaaaaaatttgcaaaggaaaatccgccaaaa
acagcgagaattcatgtgcaaattttaattggaataaaataa

DBGET integrated database retrieval system