KEGG   Lactococcus lactis subsp. lactis KF147: LLKF_2239Help
Entry
LLKF_2239         CDS       T01141                                 

Definition
(GenBank) Hypothetical protein
Organism
llk  Lactococcus lactis subsp. lactis KF147
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ADA65811
UniProt: D2BM99
Position
complement(2306111..2306311)
Genome map
AA seq 66 aa AA seqDB search
MYVVKMRGGYLCANGGPTKHLKFSTKFDTKRKAKEVAQKWLRSDIKYKVVNFENEYMLSE
IERKRG
NT seq 201 nt NT seq  +upstreamnt  +downstreamnt
atgtacgttgtaaaaatgcgtggtggctatctctgtgcgaatggtggccctacaaaacat
ttaaaattttcaacaaaatttgataccaaaagaaaagctaaagaggtggctcaaaaatgg
ttgaggagtgacatcaagtataaagttgttaattttgaaaatgagtatatgttaagtgaa
atagaaagaaagagagggtaa

DBGET integrated database retrieval system