KEGG   Lactococcus lactis subsp. lactis KF147: LLKF_2269Help
Entry
LLKF_2269         CDS       T01141                                 

Gene name
fbp
Definition
(GenBank) Fructose 1,6-bisphosphatase
  KO
K04041  fructose-1,6-bisphosphatase III [EC:3.1.3.11]
Organism
llk  Lactococcus lactis subsp. lactis KF147
Pathway
llk00010  Glycolysis / Gluconeogenesis
llk00030  Pentose phosphate pathway
llk00051  Fructose and mannose metabolism
llk00680  Methane metabolism
llk01100  Metabolic pathways
llk01110  Biosynthesis of secondary metabolites
llk01120  Microbial metabolism in diverse environments
llk01130  Biosynthesis of antibiotics
llk01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:llk00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LLKF_2269 (fbp)
   00030 Pentose phosphate pathway
    LLKF_2269 (fbp)
   00051 Fructose and mannose metabolism
    LLKF_2269 (fbp)
  Energy metabolism
   00680 Methane metabolism
    LLKF_2269 (fbp)
Enzymes [BR:llk01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     LLKF_2269 (fbp)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FBPase_2 Metallophos Metallophos_2
Motif
Other DBs
NCBI-ProteinID: ABX75755
UniProt: A9QSR9
Position
complement(2330747..2332669)
Genome map
AA seq 640 aa AA seqDB search
MQENKYLSLLAEKYETKDKVASELINLEAILNLPKGTELYISDIHAEYKAFNHIIRTGAG
NIKEKIDAIFGDEDPEEMDRLAMLIAYPTDMLQRKPKDLEAANDWSSQTIHRLIKLLRFL
GTKYSRSKVRKAVHEDFRYFTEELMLSLETNQSEKADYYQQIIKRLIELNQADKFIRSLC
MTIQQLTIDHLHVVGDVFDRGAGADKVMDRLIQFHNVDFQWGNHDVLWMGAYAGNMASLA
TLLRIAVKYNYLYELETAYSLNLRPLFLFAEEHYELNSAFKPTARPDDDLLGVENQARLT
KVHQALTVIQFKLEGQIIARRPEFEMGDRNLLEKIDYKHKTITLNDTDYPLENTCFQTVS
QYHPNELTESEAYVMAAILSSLQKSEKFQRHMQFLVEKGSAYLVYNRHLLYHGCIPLKKD
GTFLSMSIGGTLYSGRPLLDKFEEHIRRGIRHTEIYDDYSTDLMWYAWAGKCSPLFSRSS
MTTFERYFISDKTTHKEGENPYFAYREKPEIMDMILAEFGLNDPQSVVINGHTPVKVASG
ESPIKANGKLMVIDGGMSKAYQKTTGIAGYSLLNDSYGFKIVTHAPFTSIEEILAKGTGN
ESLTNFLEEKPKRRLIKDTTIGDNLRADIMDLTALMAYMP
NT seq 1923 nt NT seq  +upstreamnt  +downstreamnt
atgcaagaaaacaaatatctgtcattattagctgaaaaatatgagaccaaggacaaggtc
gcgagtgagctgatcaacttggaagctatccttaatttgcctaaggggacggagctttat
atcagtgatattcatgcggaatacaaggcttttaaccacatcattcggacaggtgctggg
aatattaaagagaaaattgatgcgatttttggggatgaagaccctgaagaaatggatcgt
ctggccatgctgattgcttatccgactgatatgttgcaacgtaagccaaaggatttggag
gctgccaacgattggtcgagtcaaacgattcatcgtctgattaagctgctgcgttttctg
gggactaaatactcccgttctaaggttcgtaaggcggttcatgaagacttccgctatttt
acggaagaattaatgctgagtttagagacgaatcagtctgagaaagcggattattatcag
cagatcattaagcgcttgatcgagctgaatcaggcggataagtttattcgaagtttgtgt
atgacgattcagcagttgacgatcgatcatctgcatgtggtgggagacgtctttgaccgt
ggtgcgggcgcggataaggtgatggatcgtttgattcagttccataatgtggatttccag
tggggcaaccatgatgtactctggatgggggcttatgctgggaacatggccagtcttgcg
acgctgcttaggattgcggtgaagtataactatctctatgagttagaaacggcctattcc
ctgaatctgcggcccttgttcttgtttgctgaagaacattatgagctgaactcggctttt
aagccgacagcacgtccggatgatgatttgctaggggtcgaaaatcaagcgcgtttgacc
aaggtccatcaggccttgacggtgattcagttcaagctagaaggccaaatcattgcgcgt
cgccctgagttcgaaatgggagatcgtaatctattagaaaaaatagactataagcacaag
accatcaccctcaatgacacagattatcccctggaaaacacgtgtttccagaccgtctcc
cagtatcatcctaacgagttgaccgaaagtgaagcctacgtcatggcggcgatcctgtcc
tctttacagaaatccgaaaaattccagcgccacatgcagtttctagtcgaaaaaggttcg
gcttatcttgtttacaaccggcatttgctctaccatggttgtattcctttgaaaaaggat
ggcacttttttatcgatgagcattggcggcactctctattctggtcgtcccttgcttgat
aagtttgaagagcacatcagacgtgggattcgccatactgagatttacgatgattactcg
actgatttgatgtggtatgcttgggccggtaaatgctcgcctttatttagtcgctcgtcc
atgacgacatttgagcgctattttatctcagataaaacgacacataaagaaggcgaaaat
ccctattttgcctacagagaaaaaccagaaatcatggacatgatcttggcagaatttggt
ttgaatgacccacagtccgttgtgattaacgggcatacacctgtcaaggttgccagtggt
gaaagtccgatcaaagccaatgggaaactcatggtgatagatggcggtatgagtaaagcc
tatcaaaaaacaaccggtatcgcaggctattccctcttaaacgattcctacggctttaaa
atcgttacccacgccccttttacgtcaattgaggagattttggccaagggaacaggtaac
gaatccttaaccaacttcttggaagaaaagcctaaacgccgcttgattaaagatacaacg
atcggcgataacttacgagctgacattatggatttgacagcgttaatggcctatatgccc
taa

DBGET integrated database retrieval system