KEGG   Lactococcus lactis subsp. lactis KF147: LLKF_2343Help
Entry
LLKF_2343         CDS       T01141                                 

Gene name
rplV
Definition
(GenBank) LSU ribosomal protein L22P
  KO
K02890  large subunit ribosomal protein L22
Organism
llk  Lactococcus lactis subsp. lactis KF147
Pathway
llk03010  Ribosome
Brite
KEGG Orthology (KO) [BR:llk00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    LLKF_2343 (rplV)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:llk03011]
    LLKF_2343 (rplV)
Ribosome [BR:llk03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    LLKF_2343 (rplV)
  Bacteria
    LLKF_2343 (rplV)
  Archaea
    LLKF_2343 (rplV)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: ADA65892
UniProt: D2BMT6
Position
complement(2392044..2392391)
Genome map
AA seq 115 aa AA seqDB search
MAEITSAKATAKTVRVSPRKTRLVIDLIRGKRVADAIAILKFTPTKAAVEVENVLNSAIA
NAENNFGLEKANLVVSETFINEGPTMKRFRPRAKGSASPINKRTAHITVVVAEKE
NT seq 348 nt NT seq  +upstreamnt  +downstreamnt
atggcagaaattacttcagctaaagcaactgcaaaaacagttcgcgtttcacctcgtaag
actcgtcttgttatcgatcttatccgcgggaaacgtgttgcagatgcaattgcaatcttg
aaatttacaccgactaaagctgctgtagaagttgaaaacgtacttaatagtgctatcgct
aatgcagaaaataactttggtcttgaaaaagctaacttggtagtaagcgaaacatttatt
aatgaaggtccaacaatgaaacgtttccgtccacgtgccaaaggttcagcttcaccaatt
aacaaacgcacagctcacatcactgtagttgtagctgagaaagaataa

DBGET integrated database retrieval system