KEGG   Lactococcus lactis subsp. cremoris MG1363: llmg_0172Help
Entry
llmg_0172         CDS       T00475                                 

Gene name
codY
Definition
(GenBank) transcriptional regulator
  KO
K03706  transcriptional pleiotropic repressor
Organism
llm  Lactococcus lactis subsp. cremoris MG1363
Brite
KEGG Orthology (KO) [BR:llm00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:llm03000]
    llmg_0172 (codY)
Transcription factors [BR:llm03000]
 Prokaryotic type
  Helix-turn-helix
   Other families
    llmg_0172 (codY)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CodY HTH_CodY HTH_11 MarR_2 HTH_Crp_2 MarR GntR Rrf2 HTH_20 HTH_24 TrmB Ribosomal_S25 HTH_41 HrcA_DNA-bdg RPA_C
Motif
Other DBs
NCBI-ProteinID: CAL96779
UniProt: A2RHP2
Position
163457..164245
Genome map
AA seq 262 aa AA seqDB search
MATLLEKTRKITAILQDGVTDLQQELPYNSMTERLANVIDCNACVINTKGELLGYSLPYN
TNNDRVDQFFYDRKLPDEYVRAAVRIYDTMANVPVDRPLAIFPEESLSDFPKGVTTLAPI
YGSGMRLGTFIMWREDGEFTDDDLVLVELATTVIGVQLSNLKLEQMEENIRKDTMATMAV
NTLSYSEMKAVKAIIEELDGEEGHVIASVIADKIGITRSVIVNALRKLESAGVIESRSLG
MKGTYLKVLNTGLFDKLAGRNF
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
gtggctacattacttgaaaaaacacgtaaaatcaccgcgattttgcaagatggagtgacc
gatttgcaacaagagttgccatacaacagtatgactgaacgcttggcaaacgtcattgat
tgcaacgcctgcgtgattaatacgaagggcgagttgcttggttactcattgccttacaat
acaaacaatgatcgcgttgaccaatttttctacgatcgtaaattgcctgacgaatacgtt
cgtgcagcagtacgtatttacgatacaatggcaaacgttcctgttgatcgtcctttagca
attttcccagaagaaagtcttagcgattttccaaaaggtgtaacaactttagcgcctatc
tatggttctggaatgcgtcttggaacatttattatgtggcgtgaagatggtgaatttaca
gatgacgatcttgttttggttgagcttgcaacaacagtaatcggtgtacaactctcaaac
cttaaacttgaacaaatggaagaaaatatccgtaaagacactatggcaacaatggctgtt
aatacactttcttactcagaaatgaaagctgtcaaagcaattattgaagaacttgatggt
gaagaagggcatgttattgcctctgtcattgctgacaagattggtattacacgttcagtg
attgttaatgctttacgtaaacttgaatctgctggtgttattgaatcacgttcacttggt
atgaaaggaacttatcttaaagttcttaatactggtttgtttgataaacttgctggacgt
aatttctaa

DBGET integrated database retrieval system