KEGG   Lactococcus lactis subsp. cremoris MG1363: llmg_0177Help
Entry
llmg_0177         CDS       T00475                                 

Definition
(GenBank) amidase
  KO
K01426  amidase [EC:3.5.1.4]
Organism
llm  Lactococcus lactis subsp. cremoris MG1363
Pathway
llm00330  Arginine and proline metabolism
llm00360  Phenylalanine metabolism
llm00380  Tryptophan metabolism
llm00627  Aminobenzoate degradation
llm00643  Styrene degradation
llm01100  Metabolic pathways
llm01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:llm00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    llmg_0177
   00360 Phenylalanine metabolism
    llmg_0177
   00380 Tryptophan metabolism
    llmg_0177
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    llmg_0177
   00643 Styrene degradation
    llmg_0177
Enzymes [BR:llm01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.4  amidase
     llmg_0177
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase DUF4406 SPT_ssu-like
Motif
Other DBs
NCBI-ProteinID: CAL96784
UniProt: A2RHP7
Position
167870..169369
Genome map
AA seq 499 aa AA seqDB search
MLEIKDATYWAEQLKSRNLSAKELLEMTKQKIDQLNPLYNAIVAEDLAVAKEDLALTGQG
FFAGLPFALKMLGQTHKGLPDTASSQLFSENVASEDDNYVKALIRAGLTPYGQTNSPEFG
FKNISDSKLYGDTRNVWNSDYYSGGSSGGAASAVASGMFAIAGASDGGGSIRIPASFSGL
IGLKMTRGRMPQGPGSYRGWQGASISGALTVSVRDTARFILEMQTLQEAAPYQARLLDEK
ELLEVCESTDSFVSKKSSVKLKIAYSLQSPISGIELSDDALKAVKKAVEFLKGQGHELVE
IDFPLNARPLIQSYYQMNAAETVAMLEPWEKSAGRQLTSQDVELLTYALLEAGRKAPVTT
YINALAQWDQAAETFADKIYADYDLFLTPTTAKTAPKIGEELMTEEILTKMSAISQYDFE
QQIAIIEAAFERSLAFTPYNFISNLTGQPALSLPIYVNKETNLPLGIQLWGPKNSEIELL
KVAKEFENADQFILPKAYQ
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atgcttgaaattaaagatgcaacttattgggcggagcaattgaaatcaaggaatctttct
gccaaagaattattagaaatgacaaagcaaaaaattgatcagctcaatccactctacaat
gcgattgtggcagaggatttagcggtcgcaaaagaagatttagctttgacaggtcaaggt
ttttttgcaggactgccatttgcgttgaaaatgttggggcaaacgcataaaggattgcct
gatacagctagctctcagctcttttcagagaatgtggcatctgaggatgataattatgtt
aaagcgctgataagggcaggattgacgccttatgggcagacgaattcgccagagtttggt
tttaaaaatatttcggattcaaaactctacggtgatacacgaaatgtttggaattctgat
tattattcgggtgggtcatctggtggtgcggcttcagccgtggcttctgggatgtttgcg
attgctggagcttctgatggcggagggtcaattcggattccagcctcattttcaggtttg
attggtctaaagatgacgcgtggacgaatgccacaagggccgggctcttatcgagggtgg
caaggtgcatctatttcaggggcattaacagtatcggtgcgagatacggcaagatttatt
ttggaaatgcaaactttgcaagaggcagcgccttatcaggctcgcttgttagatgaaaaa
gaacttttagaagtctgtgaatctactgacagttttgtcagtaaaaaatcgtcagtaaaa
ttaaaaattgcttattctttgcaaagtccgatttctggaattgaactttctgatgatgct
ctaaaagcggtcaaaaaagctgttgaattcttaaaaggacagggacatgaacttgtggaa
attgattttccattgaatgcacgtcctttaattcaatcttattatcagatgaatgcagcg
gaaacggtggctatgcttgaaccttgggaaaaatcagcgggtcgccaattgacaagtcaa
gatgttgaacttttgacttatgcccttttagaagctggacgaaaagcgcccgtcaccact
tatattaatgctttggctcaatgggatcaggcagccgaaacctttgctgacaagatttat
gctgactatgatttatttttgaccccaactacggcaaaaacagcgccaaaaattggtgaa
gaattaatgacagaggaaatattgaccaaaatgtcagcaatcagtcaatatgattttgaa
caacaaatagcaattattgaggcggcttttgagcgttcattggcctttacaccctataat
ttcatcagtaatttgacgggacaaccagctctttcactaccgatttatgtcaataaagaa
acaaatcttccattggggattcaactctggggacctaaaaattctgaaattgaattacta
aaagtagctaaagaatttgaaaatgctgatcagtttattttgccaaaagcttatcagtaa

DBGET integrated database retrieval system