KEGG   Lactococcus lactis subsp. cremoris MG1363: llmg_0264Help
Entry
llmg_0264         CDS       T00475                                 

Gene name
fbp
Definition
(GenBank) fructose-bisphosphatase
  KO
K04041  fructose-1,6-bisphosphatase III [EC:3.1.3.11]
Organism
llm  Lactococcus lactis subsp. cremoris MG1363
Pathway
llm00010  Glycolysis / Gluconeogenesis
llm00030  Pentose phosphate pathway
llm00051  Fructose and mannose metabolism
llm00680  Methane metabolism
llm01100  Metabolic pathways
llm01110  Biosynthesis of secondary metabolites
llm01120  Microbial metabolism in diverse environments
llm01130  Biosynthesis of antibiotics
llm01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:llm00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    llmg_0264 (fbp)
   00030 Pentose phosphate pathway
    llmg_0264 (fbp)
   00051 Fructose and mannose metabolism
    llmg_0264 (fbp)
  Energy metabolism
   00680 Methane metabolism
    llmg_0264 (fbp)
Enzymes [BR:llm01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     llmg_0264 (fbp)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FBPase_2 Metallophos Metallophos_2
Motif
Other DBs
NCBI-ProteinID: CAL96871
UniProt: A2RHX9
Position
250908..252830
Genome map
AA seq 640 aa AA seqDB search
MDKKYYQLLKKQFSSKEAVLTEIINLSAICELPKATEHFMSDVHGEYDAFNHVLRNGSGS
IKEKLRDCFPQFSSAEISSVATLIYYPQEKLDSECQLQDKKLFEHYCRLNLVYLLKTVKF
VGQKYTRSKVRKAFPEKFRYILEELINEVDSTTDKQDYFDSILSQLQNLGELTRLIVALA
DTIRRLTVDHLHVVGDIYDRGPYPDKIIDRLINMPSVDVQWGNHDIVWMAAFSGSPLAMM
NVIRICARYGNLDILEESYGINLRAILEYAERYYEPSEAFRPRLVDGVRLSADEKALLNK
LQQTTAILQFKLESQLIERRPDFQLEHRDLLHFIDFSQNKIELAGETYDLIDFQAPTINP
EQPASLTEEEEKIIAHLLNNFKTSDKLKRHVGFLQEKGAMYLSYNGNLLIHGCLPLHENG
DFKSFTIDKKAYAGRDLLDFFDSEVRKCLAHPEESEDLATDLMWYLWVGECSSLFGKTAM
TTFERYYIKDKSTHVEKKNPYYQLREQPKIITKILENFGLDENGHLVNGHTPIKEKNGEN
PIKADGKLIVIDGGFAKAYQKETGIAGYTLLYNSFGIQLVAHQPFSTVKAAVEKGTDIIS
LKRLVAEVDERKRVKDTNVGQTLLSEIADLEVLFEHYEDY
NT seq 1923 nt NT seq  +upstreamnt  +downstreamnt
atggataaaaaatattatcagttattaaaaaagcagttttcttcaaaggaggctgtactt
acagaaattattaatttgagtgcaatttgtgaattaccaaaagcaacagagcattttatg
agtgatgtgcatggtgaatatgatgcttttaatcatgtcctaagaaatggttctggcagt
atcaaagaaaaattacgggattgttttccacaattttcgtcagcagaaatttcatcagtg
gcaaccttgatttattatccacaagagaaactagactctgaatgtcaacttcaagataaa
aagctttttgagcactattgccgtctaaacctagtctatctattgaaaacagttaaattt
gttggacaaaaatatacgcgttcaaaagttcgtaaagcttttccagaaaaatttcgctac
atcttagaagagttaatcaatgaagtggattcgacgactgataaacaggattattttgat
tcaattctttcgcaactacaaaatctgggagaacttactcgcttaattgttgcacttgca
gatacaattcgcagattgacggtcgaccatctacatgttgttggggatatttatgaccgc
ggaccatatccagacaaaattattgaccgtttgataaacatgccctcagttgatgttcag
tggggcaatcatgatattgtgtggatggcggcttttagtggctcacctttggccatgatg
aatgtgataagaatttgcgcccgttacgggaatttagatattcttgaagaatcttatggg
attaatttgcgtgcgattttagaatacgctgaacgttattatgaaccaagtgaggcattt
cgtccccgtttagttgatggggttcgcttgtcagctgatgaaaaagcactgcttaataaa
ttacagcaaaccacggctattttacaatttaagttagaaagtcaactaattgaaagacgg
ccagatttccaacttgaacatcgggacctcctccattttattgatttctcacaaaataaa
atagaattagcaggtgaaacttatgatttaattgattttcaggcgcctacaattaatcct
gaacagcccgcaagtctaactgaggaagaagaaaaaataattgctcacttgttaaataat
tttaaaacttcagataagctcaagcgccatgttggattcttgcaagaaaaaggggccatg
tatctttcttacaatggcaatctattgattcatggttgccttcccttacatgaaaatgga
gattttaaatcatttacgattgataagaaggcttatgctggacgagatttacttgatttt
tttgacagtgaggttagaaaatgtcttgctcatcctgaagaatcagaggatttagcaaca
gatttgatgtggtacttatgggtgggagaatgttcttccttgtttggcaaaacagcaatg
acaacctttgaacgttattatatcaaggataaatctactcatgtagaaaagaaaaatcca
tattatcaattacgtgaacaacctaaaatcattacaaaaatcttagaaaactttggttta
gatgaaaatggacatttggttaatggtcacactccaattaaggaaaaaaatggcgagaat
ccaatcaaggcggatggaaagttgattgtgattgatggaggttttgctaaagcctatcaa
aaagaaacaggtatcgctggatatactcttctttacaatagttttggcattcaattggtt
gctcaccaacctttttcgacagtcaaagcagcggtcgaaaaaggaacagatattattagc
ttgaaacgtttagtggcggaagttgacgaacgaaagcgggtcaaagatactaatgttggg
caaactttgctaagtgaaatagcagatttagaggtgctttttgagcattatgaagattat
taa

DBGET integrated database retrieval system