KEGG   Lactococcus lactis subsp. cremoris MG1363: llmg_0334
Entry
llmg_0334         CDS       T00475                                 

Name
(GenBank) putative membrane protein
  KO
K16789  thiamine transporter
Organism
llm  Lactococcus lactis subsp. cremoris MG1363
Brite
KEGG Orthology (KO) [BR:llm00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:llm02000]
    llmg_0334
Transporters [BR:llm02000]
 Other transporters
  Electrochemical potential-driven transporters [TC:2]
   llmg_0334
SSDB
Motif
Pfam: Thia_YuaJ
Other DBs
NCBI-ProteinID: CAL96940
UniProt: A2RI47
Structure
PDB: 

Position
complement(322003..322551)
AA seq 182 aa
MSNSKFNVRLLTEIAFMAALAFIISLIPNTVYGWIIVEIACIPILLLSLRRGLTAGLVGG
LIWGILSMITGHAYILSLSQAFLEYLVAPVSLGIAGLFRQKTAPLKLAPVLLGTFVAVLL
KYFFHFIAGIIFWSQYAWKGWGAVAYSLAVNGISGILTAIAAFVILIIFVKKFPKLFIHS
NY
NT seq 549 nt   +upstreamnt  +downstreamnt
atgtctaattctaagttcaatgtccgtttattaacggaaattgccttcatggcggcactc
gccttcatcatcagcctcattccaaatactgtttatggttggattatcgttgaaatcgcc
tgtatccctatccttcttctcagcttacgacgaggtttaaccgctggtctcgttggagga
ttaatctggggaattctttcaatgattactggacatgcttatatcttaagcctatcccaa
gctttccttgaatatcttgtggctcctgtttcactcggaatagctggccttttccgccaa
aaaacagcccctctaaaactagcacctgtacttttgggaacttttgttgctgttcttctt
aaatactttttccatttcattgccggaattattttctggagccaatatgcttggaaaggt
tggggcgctgttgcttattctcttgctgttaatggaatcagcggtattttgacggccatt
gctgcctttgttatcttaataatttttgtcaaaaaattccctaaactttttatccatagt
aattactaa

DBGET integrated database retrieval system