KEGG   Lactococcus lactis subsp. cremoris MG1363: llmg_0359Help
Entry
llmg_0359         CDS       T00475                                 

Gene name
recR
Definition
(GenBank) Recombination protein recR
  KO
K06187  recombination protein RecR
Organism
llm  Lactococcus lactis subsp. cremoris MG1363
Pathway
llm03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:llm00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    llmg_0359 (recR)
DNA repair and recombination proteins [BR:llm03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecFOR pathway proteins
     llmg_0359 (recR)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      llmg_0359 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Toprim_4 RecR Toprim HHH HHH_8 HHH_5 IMS_HHH
Motif
Other DBs
NCBI-ProteinID: CAL96964
UniProt: A2RI71
Position
346899..347495
Genome map
AA seq 198 aa AA seqDB search
MYYPEPIARLIESFSKLPGIGQKTATRLAFYTIGMEDQDVNEFAKNLLSAKRDLRFCSIC
GNLTESDPCAICTDPTRDRTTILVVEESKDVLAMEKIREYRGLYHVLHGTISPMNGISPD
EINVKSLITRLMDSEVKEVIIATNATSDGEATAMYLARMIKPAGIKVTRLARGLAVGSDI
EYADEVTLSKAVENRLEI
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgtattatccagaacctattgctcgcctgattgagtcattttcaaaattacccggaatt
gggcagaaaacggcgacacggctagctttttatacgattggcatggaagatcaagatgtc
aatgaatttgcgaaaaatctcttgtcagcaaaacgagatttacgcttttgctctatttgt
gggaatttaacagaaagtgatccttgtgctatttgtactgatcccacacgtgatagaaca
acgatattggttgtcgaagaatctaaagatgttcttgccatggaaaaaatccgtgaatat
cgcggactctatcatgtcttacatggaacaattagtccaatgaacgggatctctcctgat
gaaattaatgttaaatctttgattacaaggttaatggactcagaagttaaagaagtgatt
attgcgaccaatgcaacttcggatggtgaagcaaccgctatgtatctggctcgaatgatt
aaacctgcgggaattaaagtgacacgactggctcgtggattagctgtagggtctgatata
gaatacgctgatgaggttaccttatcaaaagccgtggagaatcggttggaaatttga

DBGET integrated database retrieval system