KEGG   Lactococcus lactis subsp. cremoris MG1363: llmg_0856Help
Entry
llmg_0856         CDS       T00475                                 

Definition
(GenBank) conserved hypothetical protein
Organism
llm  Lactococcus lactis subsp. cremoris MG1363
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MFS_1 Sugar_tr
Motif
Other DBs
NCBI-ProteinID: CAL97451
UniProt: A2RJJ9
Position
822270..823712
Genome map
AA seq 480 aa AA seqDB search
MGENTVPQKSSDNVGSIVALMVALLVAIFAFQLNASMLSPALVTMQAQLHTTASSIALTQ
TIFFTAAALFALFLPRLADLIGRKKVLIGMLTLTMIGCLISGFATNVGILMIGRILQGAA
GPVVPLCLIILHVKVRDEKRYAKLMAILTSINGGIAGVDALAGGWLVSHGGFRSVFFVMG
ITAALAILLVSFGTQESTAKDTPKMDWTGVILLVVAMGALLSAVNALQGSFGNLGLPNWL
LASILALLGLICFVGFWQVEKRVNHPMVPIHYLKQRRTWGLLITTLLTMTGVFAIMNGII
PALGQDGKFGLGLGADMVSLVTLTPYALAGLFFGPVSGFLAARFGFAKVLRVGLLTTIIG
IVLAVAGVLQPSIWLLLLVSTFIGITYAGITNIMLNGLGIVLSPEDNPGYLPGLNAGMFN
LGAGLSFIILYAVPTVLHTSVGGSSSGYISGIVTGLILVIIAFFTSFLIPDSKDCKINLE
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
atgggagaaaatactgttcctcaaaaatctagtgataatgtgggctcaatagtggcttta
atggtcgccctattggtagcaatctttgcttttcagcttaatgcttcaatgctctcgcct
gctttggttaccatgcaggctcaattacatacgacagcttcgtctatagcactgacacaa
accatcttttttacagctgcggccttatttgctttgtttttgcctcgtttggcagattta
attggacgaaaaaaagttctgattgggatgcttaccttaacaatgattggttgtcttatt
tctggatttgcgactaatgtaggaattttgatgattggtcgtatcttacaaggtgctgct
ggacctgtagttccactttgtttaatcatcttgcacgtgaaagtgcgtgatgagaagaga
tatgcaaaattaatggccatacttacttcaattaatggtggaattgctggagttgatgcc
ttagcaggtggctggttagtgagccatggtggtttccgttcagtattttttgttatggga
attacggcagcacttgctattcttttagtaagttttggaacgcaagagtcaactgcaaaa
gatacaccaaaaatggattggactggagtcattcttttagtagtagcaatgggtgcgctc
ttgagtgcggttaatgctttgcaaggaagctttggaaatcttggacttcctaattggctt
ttagcttcaatcttggctcttttgggtctgatctgtttcgttggattttggcaagtggaa
aaacgagtgaaccatccgatggttcctattcattatttgaagcaaagaagaacatgggga
ttattaattacaactctattaacaatgactggtgtttttgcaattatgaatggaattatt
cctgctttaggtcaagatggtaagtttggtttgggacttggggcagatatggtttctctt
gttacccttactccttatgcgcttgctggcttattctttggacctgtttcaggcttcttg
gctgctcgctttggttttgcgaaggtccttcgagtggggcttttaacgacgattatcgga
atagttttggctgttgctggcgtgctacaaccttcaatctggcttttattgttggtatct
accttcattgggattacctatgctgggataacaaatattatgttaaatggtctcggaatt
gtgctttcaccagaggataatccaggctatcttccaggattaaatgctggaatgtttaat
ctgggagctggtctcagcttcattattttatatgctgtaccaacagttttacatacgagt
gttggtggaagcagttctggttatatttctgggattgttacaggattgattcttgttatt
attgctttctttacttcgtttttgattccagattctaaagactgtaaaataaaccttgaa
taa

DBGET integrated database retrieval system