KEGG   Lactococcus lactis subsp. cremoris MG1363: llmg_0930Help
Entry
llmg_0930         CDS       T00475                                 

Gene name
thiL
Definition
(GenBank) ThiL protein
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
llm  Lactococcus lactis subsp. cremoris MG1363
Pathway
llm00071  Fatty acid degradation
llm00072  Synthesis and degradation of ketone bodies
llm00280  Valine, leucine and isoleucine degradation
llm00362  Benzoate degradation
llm00380  Tryptophan metabolism
llm00620  Pyruvate metabolism
llm00630  Glyoxylate and dicarboxylate metabolism
llm00640  Propanoate metabolism
llm00650  Butanoate metabolism
llm00900  Terpenoid backbone biosynthesis
llm01100  Metabolic pathways
llm01110  Biosynthesis of secondary metabolites
llm01120  Microbial metabolism in diverse environments
llm01130  Biosynthesis of antibiotics
llm01200  Carbon metabolism
llm01212  Fatty acid metabolism
llm02020  Two-component system
Brite
KEGG Orthology (KO) [BR:llm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    llmg_0930 (thiL)
   00630 Glyoxylate and dicarboxylate metabolism
    llmg_0930 (thiL)
   00640 Propanoate metabolism
    llmg_0930 (thiL)
   00650 Butanoate metabolism
    llmg_0930 (thiL)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    llmg_0930 (thiL)
   00072 Synthesis and degradation of ketone bodies
    llmg_0930 (thiL)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    llmg_0930 (thiL)
   00310 Lysine degradation
    llmg_0930 (thiL)
   00380 Tryptophan metabolism
    llmg_0930 (thiL)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    llmg_0930 (thiL)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    llmg_0930 (thiL)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    llmg_0930 (thiL)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:llm04147]
    llmg_0930 (thiL)
Enzymes [BR:llm01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     llmg_0930 (thiL)
Exosome [BR:llm04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   llmg_0930 (thiL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: CAL97524
UniProt: A2RJR9
Position
899909..901069
Genome map
AA seq 386 aa AA seqDB search
MTFGGSFVKEIVIIDALRTPVGKYDGALAEYSAEKLGTHVVSALLSKNKNIKSDVEQVIF
GNVLQAGNGQNIARQIAINSGLSTSVPASTINEVCGSGMKAVILAKQLLQLGEAEVVIAG
GTESMSNAPILKNRKTEEETLSMLSDGLIDAFSGISMGIIGETIAEQFDVSRADQDLFAQ
NSQEKAVAASQAGIFNDEIVALGKLTVDETPRPSSSLEKLATLRTAFKENGTVTAGNSSP
VNDGASALILATKEYAEKHGISYLAELVESAEVGIDPAIMGVSPIDAIQKLVQRSGVQLS
EIDLFEINEAFAASSIAVNRELGLKDSQVNIYGGAIALGHAIGSSGAKILTTLGYALKRE
QKRYGIASLCIGGGLGLAILLKNPDF
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgactttcggaggttcattcgtgaaagaaattgtaatcattgacgccttaagaacacca
gtcggaaaatatgatggtgctcttgctgagtattcggcagaaaagcttggaacacacgtt
gtttcagctttattgtcaaaaaataaaaatataaaatcagatgttgaacaagttattttt
ggtaatgttcttcaagctggtaatggtcaaaatattgcgcgccaaattgcgattaatagt
ggtttatcaaccagtgttccagcttcaaccattaatgaagtttgtggttcagggatgaag
gcagtaattctagctaagcaacttttacagttgggcgaagcagaagttgttattgctggt
ggaacggaatcaatgtctaatgcgcctattcttaaaaatcgtaaaactgaagaagaaaca
ttaagcatgttaagtgacggcttaattgatgctttttctggcatttcaatgggaattatt
ggagaaacaattgcggagcagtttgatgttagtcgtgctgaccaagacctattcgcacaa
aattctcaagagaaggcagtagcagccagtcaagcaggaatttttaatgacgagatcgta
gctcttgggaaacttactgttgatgaaactcctcgaccttcatctagcctagaaaaattg
gctacattacggacagcctttaaggaaaatggaacagttacagctgggaattcttcacca
gttaatgacggagcttctgctttaattttggccactaaagagtatgctgaaaaacatgga
atttcttatttagctgaattagttgagagtgcggaagttggtattgaccctgcaattatg
ggagtatcaccgattgatgcaattcaaaaattagttcaacgctcaggcgttcagctttca
gaaatagatctttttgaaattaatgaggcctttgctgcatcaagtattgctgttaatcgt
gaattgggcttaaaagattctcaagttaatatttatggaggagcgattgctcttggacat
gctattgggtcaagtggtgccaaaatcctgacaactttgggatatgctttgaaacgagaa
caaaagcgttatggaattgctagtctttgtattggcggtggtctagggcttgctatttta
ttgaaaaatcctgacttttaa

DBGET integrated database retrieval system