KEGG   Lactococcus lactis subsp. cremoris MG1363: llmg_1642Help
Entry
llmg_1642         CDS       T00475                                 

Gene name
butB
Definition
(GenBank) 2,3-butanediol dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
llm  Lactococcus lactis subsp. cremoris MG1363
Pathway
llm00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:llm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    llmg_1642 (butB)
Enzymes [BR:llm01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     llmg_1642 (butB)
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     llmg_1642 (butB)
    1.1.1.-  
     llmg_1642 (butB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N ADH_N Glu_dehyd_C 2-Hacid_dh_C HI0933_like Pyr_redox_2 FAD_binding_3 AlaDh_PNT_C ADH_zinc_N_2 3HCDH_N NAD_binding_8 DAO FAD_binding_2 Pyr_redox RrnaAD Pyr_redox_3 FAD_oxidored
Motif
Other DBs
NCBI-ProteinID: CAL98216
UniProt: A2RLP6
Position
complement(1620222..1621202)
Genome map
AA seq 326 aa AA seqDB search
MAWCGICGTDLHEFLDGPIFCPSAEHPNPITGEVPPVTLGHEMSGIVNFVGQGVSGLKVG
DHVVVEPYIVPEGTDTSETGHYNLSEGSNFIGLGGNGGGLAEKISVDERWVHKIPDDLPL
DEAALIEPLSVGYHAVERANLSEKSTVLVVGAGPIGLLTAAVAKAQGHTVIISEPSGLRR
KKAQEAEVADYFFNPIEDDIQAKVHQINEKGVDAAFECTSVQPGFDACLDSIRMGGTVVI
VAIWGKPASVDMAKLVIKEANLLGTIAYNNTHPKTIDLVATGKIKLNQFITGKIGLDDLI
DKGFDTLIHHNETAVKILVSPTGKGL
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
gtggcttggtgtggaatctgtggtacagatttgcacgaatttttagatggaccaattttt
tgtccatcagcagaacatccaaatcctattacaggtgaagttccaccagttactctcgga
catgaaatgtctggtattgtaaactttgtaggtcaaggggtaagtgggctcaaagtaggt
gaccatgtcgttgttgaaccttatatcgttcccgaaggtactgatacaagtgaaactgga
cattacaatctctcagaaggatcaaactttattggtttgggcggaaatggcggcggtctg
gctgaaaaaatttcagttgatgaacgttgggtacataaaattcctgacgatttaccatta
gatgaagcagcactaattgaaccactttctgtgggatatcatgctgttgaacgtgctaat
ttgagtgaaaagagtacggtactagttgttggagctggtccaatcggacttttgacagct
gcagttgccaaagctcaagggcatacagtaattattagtgagcctagtggtttgcgtcgt
aaaaaagctcaagaagcagaagttgctgattatttctttaatccaattgaagatgatatt
caggcaaaagttcatcaaattaatgaaaaaggagttgatgctgcttttgaatgtacttct
gttcaaccaggatttgatgcgtgtttagattctattcgcatgggtggaacagttgttatc
gttgcaatttggggtaaaccagctagtgttgacatggcaaaattagtcattaaagaagct
aatcttttagggactattgcttataataatactcatcctaaaaccattgatttagttgca
actggtaagattaaattgaatcaatttattacaggtaaaattggcttagatgacctgatt
gataaaggttttgatactttgattcatcacaatgaaacagcagttaagattttagtttca
ccaactggaaaaggtctataa

DBGET integrated database retrieval system