KEGG   Lactococcus lactis subsp. cremoris MG1363: llmg_1734
Entry
llmg_1734         CDS       T00475                                 

Gene name
noxB
Definition
(GenBank) NADH dehydrogenase
  KO
K03885  NADH:ubiquinone reductase (H+-translocating) [EC:7.1.1.2]
Organism
llm  Lactococcus lactis subsp. cremoris MG1363
Pathway
llm00190  Oxidative phosphorylation
Brite
KEGG Orthology (KO) [BR:llm00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    llmg_1734 (noxB)
Enzymes [BR:llm01000]
 7. Translocases
  7.1  Catalysing the translocation of hydrons
   7.1.1  Linked to oxidoreductase reactions
    7.1.1.2  NADH:ubiquinone reductase (H+-translocating)
     llmg_1734 (noxB)
SSDB
Motif
Pfam: Pyr_redox_2 Pyr_redox NAD_binding_9 Pyr_redox_3 DAO DoxX NAD_binding_8 DoxD HI0933_like Trp_halogenase AlaDh_PNT_C K_oxygenase NAD_binding_7 Methyltransf_34
Other DBs
NCBI-ProteinID: CAL98306
UniProt: A2RLY0
Position
complement(1711705..1713708)
AA seq 667 aa
MTKKQIVVIGGGVAGVHATRELSKKLKADADITLIDKHSYHTTMTQLHEVAAGRVPFTTV
QYDFQKLLGKRKNVSLVTDSVVSLDKENKQVITKHGRYSYDYVIVALGGEPNDFGVPGVK
EHGFTLWSLEDAMRIKRHLEKIVQYASTEVDDEKRRALLTISVAGSGFTGIEMAGELIDW
RKKVSTDWKIPEEEITINVVEMMPTILNTLDRKQADKAHAYLEKKNVHVLTNHGIVEVAK
DHIKVNVGGRDEEKVAKELPTHTLIWTTGVQGNTAAKTDLNETERGHRLQANEYMEAVGF
EGKGIYVAGDVSGYIEPDTGRPTPQIVEAAEQTAHTAAANILADINGGSKHKHESKYQGT
MVSIGSTWGVAKIGSMRLTGFWAMLMKNIVYFIYTLQIRSAHYFWRYALDEVFRVKDNRN
FMRGHTSRQGNVLWAVPLRIFYGVVWFTEAIKKIVGDGQYFNPTTWFGKGSWFTNDLKFP
FSWLQEAPKAADAAAGASTAASSSSSVADAAAGATGAATTAASSGGGAAAHKATEWGLSY
AYGSDPMTVFDKVPHWMEPIFKFMIPNREVALFMQKFMSIVEIFLALALIFGLFTWIAAA
ATAALTVMFSLSGMFYWVNIWFIPVAIALMNGSGRSFGLDKWVQPWIQRWLTKIWYGQSR
SIYKGRQ
NT seq 2004 nt   +upstreamnt  +downstreamnt
atgactaagaaacaaatcgtagtcatcggtggtggtgttgcaggagtacatgcgacgcgt
gagctttctaaaaagctcaaagcagatgctgacatcacactgattgacaaacatagttac
cacacaaccatgactcaacttcacgaagttgcagcaggacgtgttccattcacaactgta
caatatgatttccaaaagcttttaggaaaacgtaaaaacgttagtcttgtcactgactct
gtcgtcagtcttgacaaagaaaacaaacaagtaatcacaaaacatggtcgttatagctat
gattatgtcattgttgcccttggtggcgaaccaaatgactttggagttcctggtgttaaa
gaacatgggtttacactttggtcacttgaagatgcaatgcgaatcaaacgtcatttggaa
aaaatcgtccaatatgcatcaacagaagttgatgatgaaaaacgccgtgctcttttaaca
atttcagttgccggatcaggatttactgggattgaaatggcaggcgaattgattgattgg
cgtaaaaaagtttcaacagattggaagattcctgaagaagaaatcacaatcaacgttgtt
gaaatgatgccaacaatccttaatactttagaccgtaaacaagcagataaagctcatgca
tatcttgaaaagaaaaatgttcacgttttaacaaaccacggtattgttgaagtagcaaaa
gatcatatcaaagtaaatgttggtgggcgtgacgaagaaaaagttgccaaagaacttcca
actcacacattaatctggacaactggtgttcaaggaaatacagctgcaaaaacagacctt
aatgaaacagaacgtggacatcgtcttcaagcaaatgaatacatggaagctgttggtttt
gaaggaaaagggatttatgttgctggtgacgtttcaggatatattgaaccagatactggt
cgtccaacaccacaaatcgttgaagctgcggaacaaacagcacacacagcagcggcaaat
attcttgcagacatcaatggtggaagcaaacataaacatgaaagtaaataccaaggaaca
atggtttcaattggttcaacttggggagttgccaaaatcggtagcatgcgtctaactggt
ttctgggcaatgttgatgaagaatattgtttactttatctatactttacaaattcgttca
gcacattatttctggcgttatgccttggatgaagtcttccgcgtaaaagataatcgtaac
tttatgcgtggtcatacttcacgtcaaggaaatgtactttgggctgttccacttcgtatt
ttctatggtgtggtttggtttaccgaagcaattaagaaaattgtcggtgatggtcaatac
ttcaacccaacgacttggtttggtaaaggttcttggtttacaaatgaccttaaattccca
ttctcatggttgcaagaagcaccaaaagcagctgacgcagccgcaggcgcttcaacagct
gcttcatcaagttctagtgtagccgatgcagccgcaggtgctacaggcgcagcaacaacg
gcggcttcaagtggtggtggcgcagctgctcataaagcaactgaatggggtctctcatac
gcttacggttctgacccaatgactgtttttgacaaagtgccacattggatggaacctatc
tttaagtttatgattccaaatcgtgaagtcgcattgttcatgcaaaaattcatgtcaatt
gttgaaatcttccttgcacttgcccttatttttggattgttcacttggattgcagcagca
gcaacagccgcattgactgttatgttctcactttcaggaatgttctactgggttaacatt
tggtttattccagtggcaattgcacttatgaatggttcaggtcgttcatttggtttagat
aaatgggttcaaccttggattcaaagatggctaaccaaaatatggtatggtcaatcgcgt
tcaatttacaaaggacgtcaatag

DBGET integrated database retrieval system