KEGG   Lactococcus lactis subsp. cremoris MG1363: llmg_2236Help
Entry
llmg_2236         CDS       T00475                                 

Gene name
galM
Definition
(GenBank) aldose 1-epimerase
  KO
K01785  aldose 1-epimerase [EC:5.1.3.3]
Organism
llm  Lactococcus lactis subsp. cremoris MG1363
Pathway
llm00010  Glycolysis / Gluconeogenesis
llm00052  Galactose metabolism
llm01100  Metabolic pathways
llm01110  Biosynthesis of secondary metabolites
llm01120  Microbial metabolism in diverse environments
llm01130  Biosynthesis of antibiotics
Module
llm_M00632  Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Brite
KEGG Orthology (KO) [BR:llm00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    llmg_2236 (galM)
   00052 Galactose metabolism
    llmg_2236 (galM)
Enzymes [BR:llm01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     llmg_2236 (galM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim Cna_B
Motif
Other DBs
NCBI-ProteinID: CAL98803
UniProt: A2RNB5
Position
complement(2198351..2199370)
Genome map
AA seq 339 aa AA seqDB search
MEITTKDFGLGSSLISLTNKNDVTIAFTNLGARIVDWQKDGKHFILGFDSAQEYLEKDAY
PGATVGRTAGRIKDGLVDISGKTYHLNQNEAPQTLHGGEDSIHTKLWTYEINDLGDEVQV
KFSLVSNDGENGYPGKIEMSVTHSFDEENNWKIKYEAISDKDTVFNPTGHVYFNLNGDAS
KSIENHQLKLAASRFVPLKDQTEIVRGDIVDTKNTDLDFRQEKQLSKALESSMEQVQLVG
GIDHPFLLDEQSLEKEQARLSLDDLSVSVYTDQPSIVIFTANFGDLGTVYHGKNQVHHGG
ITFECQVSPGSQQIPELGDISLKAGDEYQATTIYSLHTN
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atggaaattacaacaaaagattttggtttaggaagtagcctaattagtctaacgaacaaa
aatgatgttacaattgcttttacaaacttaggagctcgcattgttgattggcaaaaagac
gggaaacattttattttaggatttgattccgcccaagaatatttagaaaaagatgcttat
ccaggggccacagttggacgtacagctggcagaatcaaagatggtttggttgatatttct
ggaaaaacatatcatttaaatcaaaatgaagctccccaaaccttacatggtggagaagat
agcattcataccaaactttggacttatgaaattaatgatttaggagatgaagttcaagtc
aaatttagcttagtttccaatgatggagaaaatggatatcctggtaaaatagagatgtcg
gtgactcattcttttgatgaagagaacaattggaaaattaagtatgaagcaatttctgac
aaagatacggtatttaatcccacaggacatgtctatttcaacttaaatggggatgctagc
aagtctattgaaaatcatcaactcaagcttgctgcttcaagatttgtacctttaaaagat
caaacagaaattgtccgtggcgatatcgttgatacaaaaaatactgacttagacttccgt
caggaaaaacaattatcaaaagccttagagtctagcatggaacaagttcaactggttggt
ggaattgaccaccccttcttattagatgaacagagccttgagaaagaacaagcgcgttta
tctttagatgacttgtcagtttccgtttatactgaccaaccaagtattgtaatttttaca
gcaaactttggagatttggggaccgtttatcacgggaaaaatcaagttcatcatggtggt
attacctttgaatgtcaagtttcacccgggtcacaacagattccagaacttggagacatt
agtttaaaggcaggagatgaatatcaagccaccaccatttatagtttacatacaaattaa

DBGET integrated database retrieval system