KEGG   Lactococcus lactis subsp. cremoris MG1363: llmg_2499Help
Entry
llmg_2499         CDS       T00475                                 

Definition
(GenBank) unnamed protein product; Region start changed from 2454035 to 2454098 (-63 bases)
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Organism
llm  Lactococcus lactis subsp. cremoris MG1363
Pathway
llm00030  Pentose phosphate pathway
llm00480  Glutathione metabolism
llm01100  Metabolic pathways
llm01110  Biosynthesis of secondary metabolites
llm01120  Microbial metabolism in diverse environments
llm01130  Biosynthesis of antibiotics
llm01200  Carbon metabolism
Module
llm_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:llm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    llmg_2499
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    llmg_2499
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:llm04147]
    llmg_2499
Enzymes [BR:llm01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.49  glucose-6-phosphate dehydrogenase (NADP+)
     llmg_2499
    1.1.1.363  glucose-6-phosphate dehydrogenase [NAD(P)+]
     llmg_2499
Exosome [BR:llm04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   llmg_2499
  Exosomal proteins of colorectal cancer cells
   llmg_2499
  Exosomal proteins of bladder cancer cells
   llmg_2499
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G6PD_C G6PD_N OspE
Motif
Other DBs
NCBI-ProteinID: CAL99063
UniProt: A2RP18
Position
2454098..2455609
Genome map
AA seq 503 aa AA seqDB search
MTEQKQALFTIFGATGDLAKRKLYPSLFRLFKKGELAENFAVIGTARRPWTNDYYREVVL
ESIKGLMNSKTEAENFASHFYYQSHDVSDSSHYVNLKDLGESLRKQYKTAGNQVFFLAMA
PQFFGTIAEHLKSENILTGEGFERIVIEKPFGTSYNTAKSLNDSLSKVFTEEQIFRIDHY
LGKEMIQAVSAVRFANPIFESIWNNQHIDNVQITFAEFIGVEDRGGYYETSGALKDMIQN
HVLQVLSLIAMEKPQKFDEAHIVKEKVKALNAMRQYSPEEALNNFVRGQYVAGRFDGEDY
SGYREEDSVAPDSRTETFAAGKFVIDNERWSGVPFYVRSGKRMTEKGTRINIVFKKDPDN
LFADNCDDQSVQNILTIYIQPTEGFSLSVNGKAAGQGFHLEPLRLNFRHDSEFLGNSPEA
YEKLFLDVLNGDGTNFSHWEEAARAWELIDVIREAWDKETSELPTYAARTMGPKAAFDLL
EKEGHEWAWQPDVWYQECGYYDK
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaacaaaaacaagcacttttcaccatttttggagcaactggtgacctcgctaag
agaaagctctacccttcactctttcgtcttttcaaaaaaggcgaattggctgaaaatttt
gccgtaattggaacagcccgtcgtccttggacaaatgattattatcgtgaagttgtttta
gaatcaatcaaaggtttgatgaattcaaaaacagaagccgaaaacttcgcaagccatttt
tactatcaaagtcatgacgttagtgatagttcacattatgttaatttgaaagacttgggc
gaaagtctacgtaaacaatataaaacagctggaaatcaagttttctttctcgccatggct
ccccaattctttggcactattgccgaacacctcaaatcagaaaatattttgacaggtgaa
ggttttgaacgaatcgttatcgaaaaaccattcggtacaagttacaatactgcaaaatca
ctcaatgacagcctctctaaagtttttactgaagaacaaatcttccgaattgaccactat
ctcggtaaagaaatgattcaagctgtttcagctgtacgatttgccaaccctatttttgag
tctatttggaataatcagcacattgacaatgtccaaataacttttgctgaatttatcggc
gttgaagaccgcggaggttattacgaaacttctggtgctttgaaagatatgattcaaaat
cacgttttacaggtcctcagtctgattgctatggaaaaacctcaaaaatttgacgaagcc
catattgtcaaagaaaaagttaaggcactcaatgccatgcgtcaatattctccagaggaa
gctttaaataactttgtacgtggtcaatatgtagctggtcgctttgatggcgaagattac
tcaggctatcgtgaagaagattccgttgctccagatagccgaactgaaactttcgccgca
gggaagtttgttattgataacgaacgttggtcaggtgttcctttctatgttcgctcagga
aaacgaatgactgaaaaaggaactcgcattaatattgtattcaaaaaagaccctgataat
ctttttgctgacaattgcgatgaccagtctgtacaaaatattttaactatttatattcaa
ccaacagaaggtttttcactttctgttaacggaaaagcagccggtcaaggtttccactta
gaacctttgcgcttgaatttccgtcacgacagtgaattccttggaaattctcctgaagcg
tatgaaaaactctttttagatgttcttaatggagatggtacgaacttctctcactgggaa
gaagccgctcgtgcctgggaacttattgatgttattcgcgaagcttgggataaagaaacc
tctgaactcccaacttatgccgctcgtactatgggacctaaagctgcctttgatttactc
gaaaaagaagggcatgaatgggcttggcagcctgatgtctggtatcaagaatgtggttac
tacgataaataa

DBGET integrated database retrieval system