KEGG   Lactococcus lactis subsp. cremoris NZ9000: LLNZ_00120Help
Entry
LLNZ_00120        CDS       T02131                                 

Definition
(GenBank) mannitol-1-phosphate 5-dehydrogenase
  KO
K00009  mannitol-1-phosphate 5-dehydrogenase [EC:1.1.1.17]
Organism
lln  Lactococcus lactis subsp. cremoris NZ9000
Pathway
lln00051  Fructose and mannose metabolism
lln01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lln00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    LLNZ_00120
Enzymes [BR:lln01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.17  mannitol-1-phosphate 5-dehydrogenase
     LLNZ_00120
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mannitol_dh_C Mannitol_dh NAD_Gly3P_dh_N UDPG_MGDP_dh_N UPF0052
Motif
Other DBs
NCBI-ProteinID: ADJ59044
Position
30938..32104
Genome map
AA seq 388 aa AA seqDB search
MKKAVHFGAGNIGRGFIGEILSKNGFEIYFVDTNKAIIDELNTRHSYEIGIASSSPEKIS
VSGVFGINNGENPKDVIEAIAQADIVTTAIGPNILPYIAELVAKGIQKRKEENKQVQIDI
IACENMIGGSEFLEKKVAEYLSDSDKVYLANYIGFPNAAVDRIVPGQKHEDLLYVEVEPF
CEWVIDESQIKNKSFKLEGVHYASNLEPFIERKLFSVNSGHATVAYSSAYKGYKTILEGL
QHKEILSALKGVQKETRALLLAKWPQYFTEEDLMSYHQMIISRFANPKIIDEVTRVARTP
IRKLGYDERFIRPIRELNERGLSYQNHLDIVGKIFAYQDENDSQSVQLQEKLSTMDFQRL
IEEVTGLSNKKIILEIELVIKKYKNDSK
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaagcagtacattttggtgcaggaaatattggtcgtggttttattggggaaatt
ctaagtaaaaatggctttgagatttacttcgttgacacgaataaggcgataattgatgaa
cttaatactcgtcattcttatgaaattggtatcgcaagtagtagtcctgaaaaaatttct
gtttcaggagtatttgggattaacaatggtgaaaatcctaaggatgtaattgaggcaatt
gctcaagctgatatagtaacgacagcaattggaccaaatattttgccttatattgctgag
cttgttgccaaaggcattcaaaaacgtaaagaagagaataagcaagtccaaatagatatt
attgcttgtgaaaatatgattgggggctcagagtttttagaaaagaaggtggctgaatat
ttatcagactctgataaagtttaccttgcaaactacatagggtttcccaatgctgctgtt
gaccgcattgtacctggtcaaaagcatgaagatcttctttatgttgaagtagagcccttt
tgtgagtgggtgattgacgagagtcagataaaaaataaaagttttaaacttgaaggcgtt
cattatgccagtaatcttgaacctttcatagagcgtaaacttttctctgtaaactcagga
cacgctacagtcgcttattctagcgcatataaaggttataaaacaattttggaaggttta
cagcacaaagagattttaagtgctttaaagggtgtacagaaagaaacacgcgctttactt
ttagccaaatggccccaatattttacggaagaagatttgatgagctatcatcaaatgatt
atctctcgctttgctaatccaaaaattattgatgaggtgacacgggttgcacgaacacct
attcgaaagttaggttatgacgaacgctttattcgacctattcgtgaattaaatgaacgt
ggtctctcttatcaaaatcatttagatattgttggaaaaatttttgcttaccaggatgaa
aatgatagtcagtcggttcaacttcaagaaaagcttagcacaatggattttcaaaggctt
attgaagaagtcacgggtctatcaaataaaaaaataattttggaaatcgaactagtgatt
aagaaatataaaaatgacagcaagtag

DBGET integrated database retrieval system