KEGG   Lactococcus lactis subsp. cremoris NZ9000: LLNZ_01315Help
Entry
LLNZ_01315        CDS       T02131                                 

Definition
(GenBank) cryptic haloacid dehalogenase 1
  KO
K01560  2-haloacid dehalogenase [EC:3.8.1.2]
Organism
lln  Lactococcus lactis subsp. cremoris NZ9000
Pathway
lln00361  Chlorocyclohexane and chlorobenzene degradation
lln00625  Chloroalkane and chloroalkene degradation
lln01100  Metabolic pathways
lln01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:lln00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    LLNZ_01315
   00361 Chlorocyclohexane and chlorobenzene degradation
    LLNZ_01315
Enzymes [BR:lln01000]
 3. Hydrolases
  3.8  Acting on halide bonds
   3.8.1  In carbon-halide compounds
    3.8.1.2  (S)-2-haloacid dehalogenase
     LLNZ_01315
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HAD_2 Hydrolase Hydrolase_6 HAD Hydrolase_like
Motif
Other DBs
NCBI-ProteinID: ADJ59277
Position
240928..241602
Genome map
AA seq 224 aa AA seqDB search
MTGKYPILVFDINETLLSFESLERFFAKYFDDKKVLRQWFSEQILYSQALTLSRNYYDFG
ELATSVLQMVAELHNLSLNDRVLLEFKQLLGQLLPYPEVEKGLEMLKQSGFRMIALTNSP
TLSSQVSLERSGLRKYFENVISVEEVQQYKPAPATYRRVRELIGFEEKYCMIACHIWDLL
GAQSENFDTAFIKRQGNATLPNLFQANFVADDLQELSKLLIKKY
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
atgacaggaaaataccctattcttgtttttgatatcaatgaaaccttgctaagtttcgaa
agcttagaaaggtttttcgctaaatattttgatgataaaaaagtactacgtcagtggttt
tctgaacaaattttatacagtcaggctctaaccttgagtaggaactattatgattttgga
gaacttgcgacatcagttttgcaaatggttgctgaactccataatctttctttaaatgat
agagttttgttagagttcaaacagttgcttggacagctcctgccttatccagaggtagaa
aaaggacttgaaatgttgaaacaatcaggtttccgtatgattgctttgactaattcacct
acgcttagcagtcaggtttcgcttgaacgctctggtctacgtaagtattttgaaaatgtc
atctctgtggaagaagttcagcagtataaaccagccccagccacttatagacgagttcgt
gagttaattggatttgaggaaaaatattgcatgattgcttgtcatatttgggatttatta
ggcgctcaaagtgaaaactttgataccgcttttatcaaacgacaaggcaatgcgactttg
cccaatctatttcaagctaattttgtagctgatgatttacaagaattatcaaaattgcta
ataaaaaaatattaa

DBGET integrated database retrieval system