KEGG   Lactococcus lactis subsp. cremoris NZ9000: LLNZ_04685Help
Entry
LLNZ_04685        CDS       T02131                                 

Gene name
murD
Definition
(GenBank) UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase
  KO
K01925  UDP-N-acetylmuramoylalanine--D-glutamate ligase [EC:6.3.2.9]
Organism
lln  Lactococcus lactis subsp. cremoris NZ9000
Pathway
lln00471  D-Glutamine and D-glutamate metabolism
lln00550  Peptidoglycan biosynthesis
lln01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lln00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    LLNZ_04685 (murD)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    LLNZ_04685 (murD)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:lln01011]
    LLNZ_04685 (murD)
Enzymes [BR:lln01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.9  UDP-N-acetylmuramoyl-L-alanine---D-glutamate ligase
     LLNZ_04685 (murD)
Peptidoglycan biosynthesis and degradation proteins [BR:lln01011]
 Precursor biosynthesis
  Amino acid ligase
   LLNZ_04685 (murD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mur_ligase_M Mur_ligase_C Mur_ligase Pyr_redox_3 TPP_enzyme_M AlaDh_PNT_C CBP_GIL
Motif
Other DBs
NCBI-ProteinID: ADJ59924
Position
879291..880640
Genome map
AA seq 449 aa AA seqDB search
MKKITKFKDQKILVLGLARSGMAAALVLNELGAIVTVNDGKPFEENKEAQVLLEEGIKVI
TGSHPIDLLDEDFALMVKNPGIRYDNPMVERAEALKIPVITEVELAYLVSEAPIIGITGT
NGKTTTTTLIADILNADGQSAKLSGNIGFPASEVAQKAQATDTLVMELSSFQLMGIDTFR
PKIALITNLFSAHLDYHGSQEAYEAAKWRIQENMTADDFLILNFNQEKCRKLADKTKATV
LAFSTKEKVSGAYVNEGKIYFKDEFIMEASELSLPGDHNLENALAAIVASKLRGAENEAI
VEVLTSFAGVKHRLQYLGEIDGRKVYNDSKATNILATQKALSGFDNSKLWLLAGGLDRGN
GFEDLEKDLEDLKGMVVFGQTADKLRLMAEKLNIPVFASQNVATALKEIMPQTQVGDTIL
LSPACASWDQYKTFEERGDLFIEAFESLK
NT seq 1350 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaataacgaaatttaaagatcaaaaaatcttagttcttggacttgcccgttct
ggaatggctgctgctcttgtgctcaatgagttgggagcgattgttacagttaatgatggc
aaaccttttgaagaaaataaagaagctcaagtactattagaagaagggattaaagtcatc
acaggaagtcacccgattgatttgttggacgaagattttgcactgatggttaaaaatcca
ggaattcgttatgataatcccatggttgagcgagcagaagctctaaaaattccagtgatt
actgaggttgaacttgcatatttagtgagtgaggcaccaattattggcatcacaggaaca
aatggtaaaacgacaacaacgacattaattgctgatattttaaatgctgatggtcaatct
gctaagttatcaggtaatattggttttccagcgtcagaagttgcccaaaaagctcaagct
actgacacattagtgatggaactttcaagtttccaattgatgggaattgatactttcaga
cctaaaattgctttaatcacaaatcttttttctgctcatttggactaccatggttcacaa
gaagcatatgaagctgctaaatggcggattcaagaaaatatgacagcagatgatttccta
attctcaattttaaccaagaaaaatgccgtaaattagcagataaaacaaaggcaacggtc
cttgctttttcaactaaagaaaaagtttcaggtgcttatgttaatgaggggaaaatttat
tttaaagatgaatttatcatggaagcttctgagctttcacttcctggggatcataattta
gaaaatgctttagcggcaattgtcgcttcaaaattacgcggagcagaaaatgaagcaatt
gtcgaagtactgacaagttttgcaggtgtaaaacatcggttgcaatatctaggtgaaatt
gatggacgaaaagtctataatgacagtaaagcaactaatattttggctactcaaaaagcc
ttgtcaggatttgacaacagtaaactttggcttttagctggtggacttgaccgaggcaat
ggctttgaagacttagaaaaagatttagaagacttaaaaggaatggttgtctttggacaa
actgcggataaattgcggttgatggctgaaaaattgaatattcctgtgtttgctagtcaa
aatgttgcaactgctcttaaagaaatcatgcctcaaacgcaagttggtgataccatttta
cttagcccagcttgtgcaagttgggatcaatataaaacctttgaagaacgaggtgattta
tttatcgaggcttttgagagcttaaaataa

DBGET integrated database retrieval system