KEGG   Lactococcus lactis subsp. cremoris NZ9000: LLNZ_04785Help
Entry
LLNZ_04785        CDS       T02131                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
lln  Lactococcus lactis subsp. cremoris NZ9000
Pathway
lln00071  Fatty acid degradation
lln00072  Synthesis and degradation of ketone bodies
lln00280  Valine, leucine and isoleucine degradation
lln00362  Benzoate degradation
lln00380  Tryptophan metabolism
lln00620  Pyruvate metabolism
lln00630  Glyoxylate and dicarboxylate metabolism
lln00640  Propanoate metabolism
lln00650  Butanoate metabolism
lln00900  Terpenoid backbone biosynthesis
lln01100  Metabolic pathways
lln01110  Biosynthesis of secondary metabolites
lln01120  Microbial metabolism in diverse environments
lln01130  Biosynthesis of antibiotics
lln01200  Carbon metabolism
lln01212  Fatty acid metabolism
lln02020  Two-component system
Brite
KEGG Orthology (KO) [BR:lln00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    LLNZ_04785
   00630 Glyoxylate and dicarboxylate metabolism
    LLNZ_04785
   00640 Propanoate metabolism
    LLNZ_04785
   00650 Butanoate metabolism
    LLNZ_04785
  09103 Lipid metabolism
   00071 Fatty acid degradation
    LLNZ_04785
   00072 Synthesis and degradation of ketone bodies
    LLNZ_04785
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    LLNZ_04785
   00310 Lysine degradation
    LLNZ_04785
   00380 Tryptophan metabolism
    LLNZ_04785
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    LLNZ_04785
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    LLNZ_04785
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    LLNZ_04785
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lln04147]
    LLNZ_04785
Enzymes [BR:lln01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     LLNZ_04785
Exosome [BR:lln04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   LLNZ_04785
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: ADJ59940
Position
900763..901902
Genome map
AA seq 379 aa AA seqDB search
MKEIVIIDALRTPVGKYDGALAEYSAEKLGTHVVSALLSKNKNIKSDVEQVIFGNVLQAG
NGQNIARQIAINSGLSTSVPASTINEVCGSGMKAVILAKQLLQLGEAEVVIAGGTESMSN
APILKNRKTEEETLSMLSDGLIDAFSGISMGIIGETIAEQFDVSRADQDLFAQNSQEKAV
AASQAGIFNDEIVALGKLTVDETPRPSSSLEKLATLRTAFKENGTVTAGNSSPVNDGASA
LILATKEYAEKHGISYLAELVESAEVGIDPAIMGVSPIDAIQKLVQRSGVQLSEIDLFEI
NEAFAASSIAVNRELGLKDSQVNIYGGAIALGHAIGSSGAKILTTLGYALKREQKRYGIA
SLCIGGGLGLAILLKNPDF
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
gtgaaagaaattgtaatcattgacgccttaagaacaccagtcggaaaatatgatggtgct
cttgctgagtattcggcagaaaagcttggaacacacgttgtttcagctttattgtcaaaa
aataaaaatataaaatcagatgttgaacaagttatttttggtaatgttcttcaagctggt
aatggtcaaaatattgcgcgccaaattgcgattaatagtggtttatcaaccagtgttcca
gcttcaaccattaatgaagtttgtggttcagggatgaaggcagtaattctagctaagcaa
cttttacagttgggcgaagcagaagttgttattgctggtggaacggaatcaatgtctaat
gcgcctattcttaaaaatcgtaaaactgaagaagaaacattaagcatgttaagtgacggc
ttaattgatgctttttctggcatttcaatgggaattattggagaaacaattgcggagcag
tttgatgttagtcgtgctgaccaagacctattcgcacaaaattctcaagagaaggcagta
gcagccagtcaagcaggaatttttaatgacgagatcgtagctcttgggaaacttactgtt
gatgaaactcctcgaccttcatctagcctagaaaaattggctacattacggacagccttt
aaggaaaatggaacagttacagctgggaattcttcaccagttaatgacggagcttctgct
ttaattttggccactaaagagtatgctgaaaaacatggaatttcttatttagctgaatta
gttgagagtgcggaagttggtattgaccctgcaattatgggagtatcaccgattgatgca
attcaaaaattagttcaacgctcaggcgttcagctttcagaaatagatctttttgaaatt
aatgaggcctttgctgcatcaagtattgctgttaatcgtgaattgggcttaaaagattct
caagttaatatttatggaggagcgattgctcttggacatgctattgggtcaagtggtgcc
aaaatcctgacaactttgggatatgctttgaaacgagaacaaaagcgttatggaattgct
agtctttgtattggcggtggtctagggcttgctattttattgaaaaatcctgacttttaa

DBGET integrated database retrieval system