KEGG   Lactococcus lactis subsp. cremoris NZ9000: LLNZ_04790Help
Entry
LLNZ_04790        CDS       T02131                                 

Definition
(GenBank) MvaA protein
  KO
K00054  hydroxymethylglutaryl-CoA reductase [EC:1.1.1.88]
Organism
lln  Lactococcus lactis subsp. cremoris NZ9000
Pathway
lln00900  Terpenoid backbone biosynthesis
lln01110  Biosynthesis of secondary metabolites
lln01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:lln00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    LLNZ_04790
Enzymes [BR:lln01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.88  hydroxymethylglutaryl-CoA reductase
     LLNZ_04790
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HMG-CoA_red
Motif
Other DBs
NCBI-ProteinID: ADJ59941
Position
901950..903182
Genome map
AA seq 410 aa AA seqDB search
MRKKFYQMSPQERLNSLNLSEKSQEILSEMALDTTILDNLIENQISEFELPMGIAQNFVI
NGQSFLIPMVTEEPSVIAAASNGAKIAGNFVAEIKERLMRGQIVFYDVKNSDKIANEILE
KQEKIFEQAELSYPSIVKRGGGLREVSSRIFSSQKFLSVDVKVDVKDAMGANIINSILEG
IAELFRRWFPDEKILFSILSNYATESLVKVTCEIPVERLSKKADGYEIGQKIMAASQYSK
IDPYRASTHNKGIMNGINAVILATGNDTRAISAAIHAYAAKDGAYQGLANWELQEKMLVG
ELEFPLPVATVGGGVKVLPKAQAAMEILGISDAKELAKVIAAVGLAQNLAALRALVSEGI
QQGHMSLQARSLALSVGAQADEIAILSQQLRKEKVMNQEVAQNLLKNLRK
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaaaaattttatcaaatgtcgccacaagagcgattgaattcgttaaacttatcc
gaaaagagtcaagaaattttaagtgagatggccctagatacaactattttggacaatctc
atagaaaatcaaatttctgaatttgaattgccaatgggaattgcccaaaattttgttatt
aatggacaaagttttctaataccaatggttacagaggaaccgtcagtaattgccgcagca
agtaatggagcaaaaatagctggaaattttgtagctgaaattaaagaacgtttaatgcgt
ggtcaaattgtattttatgatgttaaaaattcagataagattgcaaatgaaatacttgaa
aagcaagaaaaaatctttgaacaagccgaactttcttacccttcaatcgttaaacgaggt
ggcggtttgagagaggtttctagtcggattttctctagtcaaaagtttttatctgttgat
gtcaaggttgatgttaaagacgccatgggtgcaaatattattaattcaatcttagaggga
attgctgaactctttcggaggtggtttcctgatgaaaaaattctgtttagtattttatca
aattatgctactgaatcactagtgaaagtgacctgtgaaattccggttgaacgcctttca
aaaaaagcagatggatatgaaattggtcaaaaaattatggctgcttcccaatattcaaaa
attgatccttatcgtgctagcacccataacaaagggattatgaacggtatcaatgcggtc
attttagctacaggaaatgatactcgggccatctcagctgctattcatgcttatgcggca
aaagatggagcctaccaagggttagccaactgggaacttcaagagaaaatgttagttggc
gaactcgaatttcctttaccagtggcaactgtcggagggggagtcaaggttttgccaaaa
gcacaagcggccatggagattctgggtatcagtgatgctaaggagctcgcaaaagttatt
gctgcagtgggactagctcaaaacttagccgctttacgtgccctagtttcagaaggaatt
caacagggacacatgagtctacaagctcgttctttggctttgagtgtaggagcacaagcg
gatgaaatcgcgatattaagtcaacaattgcgcaaagaaaaagtgatgaatcaagaagta
gcccaaaatttactaaaaaatttgagaaaataa

DBGET integrated database retrieval system