KEGG   Lactococcus lactis subsp. cremoris NZ9000: LLNZ_07340Help
Entry
LLNZ_07340        CDS       T02131                                 

Gene name
tpiA
Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
lln  Lactococcus lactis subsp. cremoris NZ9000
Pathway
lln00010  Glycolysis / Gluconeogenesis
lln00051  Fructose and mannose metabolism
lln00562  Inositol phosphate metabolism
lln01100  Metabolic pathways
lln01110  Biosynthesis of secondary metabolites
lln01120  Microbial metabolism in diverse environments
lln01130  Biosynthesis of antibiotics
lln01200  Carbon metabolism
lln01230  Biosynthesis of amino acids
Module
lln_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
lln_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:lln00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LLNZ_07340 (tpiA)
   00051 Fructose and mannose metabolism
    LLNZ_07340 (tpiA)
   00562 Inositol phosphate metabolism
    LLNZ_07340 (tpiA)
Enzymes [BR:lln01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     LLNZ_07340 (tpiA)
Exosome [BR:lln04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   LLNZ_07340 (tpiA)
  Exosomal proteins of bladder cancer cells
   LLNZ_07340 (tpiA)
  Exosomal proteins of melanoma cells
   LLNZ_07340 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ADJ60414
Position
complement(1391711..1392469)
Genome map
AA seq 252 aa AA seqDB search
MSRKPIIAGNWKMNKTLSEAQAFVEAVKNNLPSSDNVESVIGAPALFLAPMAYLRQGSEL
KLAAENSYFENAGAFTGENSPAAIVDLGIEYIIIGHSERREYFHETDEDINKKAKAIFAA
GATPILCCGETLETFEAGKTAEWVSGQIEAGLAGLTAEQVSNLVIAYEPIWAIGTGKTAT
NEIADETCGVVRSTVEKLYGKEVSEAVRIQYGGSVKPETIEGLMAKENIDGALVGGASLE
ADSFLALLEMYK
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgtcacgtaaaccaattatcgctggtaactggaaaatgaataaaactttgtcagaagca
caagcttttgttgaagctgttaaaaataacttgccttcatctgataatgttgaatcagtt
atcggtgcacctgctcttttcctcgctcctatggcttaccttcgtcaaggttcagaattg
aaacttgctgctgaaaatagctacttcgaaaatgctggagcattcactggtgaaaacagc
ccagctgcaatcgttgaccttggtattgaatacatcatcatcggtcacagcgaacgtcgt
gaatatttccacgaaactgacgaagacatcaacaaaaaagcaaaagcaatcttcgctgct
ggagcaactccaatcctttgttgtggtgaaactttggaaacttttgaagctggtaaaaca
gctgaatgggtttcaggtcaaatcgaagctggtcttgcaggattgactgctgaacaagtt
tcaaacttagttatcgcttacgaaccaatctgggcaatcggaactggtaaaactgcgaca
aacgaaattgctgacgaaacttgtggtgttgtacgttcaacagttgaaaaactttacgga
aaagaagtttcagaagctgtacgtatccaatacggtggatcagtaaaacctgaaacaatc
gaaggattgatggctaaagaaaacatcgacggtgccctcgttggtggagcttcacttgaa
gctgatagcttccttgcattgcttgaaatgtacaaataa

DBGET integrated database retrieval system