KEGG   Lactococcus lactis subsp. cremoris NZ9000: LLNZ_08450Help
Entry
LLNZ_08450        CDS       T02131                                 

Definition
(GenBank) 2,3-butanediol dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
lln  Lactococcus lactis subsp. cremoris NZ9000
Pathway
lln00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:lln00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    LLNZ_08450
Enzymes [BR:lln01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     LLNZ_08450
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     LLNZ_08450
    1.1.1.-  
     LLNZ_08450
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N ADH_N Glu_dehyd_C 2-Hacid_dh_C HI0933_like Pyr_redox_2 FAD_binding_3 AlaDh_PNT_C ADH_zinc_N_2 3HCDH_N NAD_binding_8 DAO FAD_binding_2 Pyr_redox RrnaAD Pyr_redox_3 FAD_oxidored
Motif
Other DBs
NCBI-ProteinID: ADJ60628
Position
complement(1621057..1622037)
Genome map
AA seq 326 aa AA seqDB search
MAWCGICGTDLHEFLDGPIFCPSAEHPNPITGEVPPVTLGHEMSGIVNFVGQGVSGLKVG
DHVVVEPYIVPEGTDTSETGHYNLSEGSNFIGLGGNGGGLAEKISVDERWVHKIPDDLPL
DEAALIEPLSVGYHAVERANLSEKSTVLVVGAGPIGLLTAAVAKAQGHTVIISEPSGLRR
KKAQEAEVADYFFNPIEDDIQAKVHQINEKGVDAAFECTSVQPGFDACLDSIRMGGTVVI
VAIWGKPASVDMAKLVIKEANLLGTIAYNNTHPKTIDLVATGKIKLNQFITGKIGLDDLI
DKGFDTLIHHNETAVKILVSPTGKGL
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
gtggcttggtgtggaatctgtggtacagatttgcacgaatttttagatggaccaattttt
tgtccatcagcagaacatccaaatcctattacaggtgaagttccaccagttactctcgga
catgaaatgtctggtattgtaaactttgtaggtcaaggggtaagtgggctcaaagtaggt
gaccatgtcgttgttgaaccttatatcgttcccgaaggtactgatacaagtgaaactgga
cattacaatctctcagaaggatcaaactttattggtttgggcggaaatggcggcggtctg
gctgaaaaaatttcagttgatgaacgttgggtacataaaattcctgacgatttaccatta
gatgaagcagcactaattgaaccactttctgtgggatatcatgctgttgaacgtgctaat
ttgagtgaaaagagtacggtactagttgttggagctggtccaatcggacttttgacagct
gcagttgccaaagctcaagggcatacagtaattattagtgagcctagtggtttgcgtcgt
aaaaaagctcaagaagcagaagttgctgattatttctttaatccaattgaagatgatatt
caggcaaaagttcatcaaattaatgaaaaaggagttgatgctgcttttgaatgtacttct
gttcaaccaggatttgatgcgtgtttagattctattcgcatgggtggaacagttgttatc
gttgcaatttggggtaaaccagctagtgttgacatggcaaaattagtcattaaagaagct
aatcttttagggactattgcttataataatactcatcctaaaaccattgatttagttgca
actggtaagattaaattgaatcaatttattacaggtaaaattggcttagatgacctgatt
gataaaggttttgatactttgattcatcacaatgaaacagcagttaagattttagtttca
ccaactggaaaaggtctataa

DBGET integrated database retrieval system