KEGG   Legionella longbeachae: LLO_0275Help
Entry
LLO_0275          CDS       T01183                                 

Gene name
tpi
Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
llo  Legionella longbeachae
Pathway
llo00010  Glycolysis / Gluconeogenesis
llo00051  Fructose and mannose metabolism
llo00562  Inositol phosphate metabolism
llo01100  Metabolic pathways
llo01110  Biosynthesis of secondary metabolites
llo01120  Microbial metabolism in diverse environments
llo01130  Biosynthesis of antibiotics
llo01200  Carbon metabolism
llo01230  Biosynthesis of amino acids
Module
llo_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:llo00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LLO_0275 (tpi)
   00051 Fructose and mannose metabolism
    LLO_0275 (tpi)
   00562 Inositol phosphate metabolism
    LLO_0275 (tpi)
Enzymes [BR:llo01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     LLO_0275 (tpi)
Exosome [BR:llo04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   LLO_0275 (tpi)
  Exosomal proteins of bladder cancer cells
   LLO_0275 (tpi)
  Exosomal proteins of melanoma cells
   LLO_0275 (tpi)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: CBJ10603
Pasteur: llo0275
UniProt: D3HNZ0
Position
310210..310959
Genome map
AA seq 249 aa AA seqDB search
MRQTIVAGNWKMNGQLRQVVQLTNEIKELLQSIKKTRVVIMPPAIYIPQVRDLVAECDIA
LGAQNVYPKDFGAYTGEISAPMLKDFNCRYILVGHSERRHGFQEDEKFVAQKFHHVKEHG
MIPILCVGETLGEREKGHTEQVIANQLLAVSEADKNCFSDCVVAYEPVWAIGTGKTASPE
QAQEVHRFIRKLVAGVNDSDAQQLPLLYGGSVNEDNARALFSMPDVDGGLVGGASLNAKQ
FVEIVKCIN
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgagacagacaatagtcgctggcaactggaaaatgaatggtcagctacgccaggtagtt
caattaaccaatgagattaaagaactgctccagtctattaaaaagacccgtgttgtaatt
atgccgcctgcaatttatataccgcaagtaagagacttagtggcggaatgtgatattgcg
ctaggggcacagaatgtatacccaaaggatttcggtgcatataccggcgagatttctgct
cccatgttaaaagactttaactgccgttatattttggtaggtcattctgaaagaagacat
ggatttcaggaagatgaaaaatttgtcgcgcaaaaattccaccatgtgaaagaacatggt
atgatacccattctttgtgtcggtgaaactctaggtgagcgcgaaaaaggacatacagaa
caagtaattgcaaatcaactactggcggtaagtgaagcggataaaaactgctttagtgat
tgtgtagtggcttacgaacctgtttgggcaataggtactggaaagactgcatcaccagaa
caagctcaagaagttcatagattcattaggaagttggttgcaggagtaaatgatagcgat
gcacaacaactacccctcctttatggtggtagtgtaaatgaagataatgctagggcacta
ttttcgatgccagatgttgatggtggcttggtagggggagcatcgttgaacgcgaaacag
tttgtggaaattgtgaaatgtatcaattga

DBGET integrated database retrieval system