KEGG   Legionella longbeachae: LLO_0491Help
Entry
LLO_0491          CDS       T01183                                 

Gene name
rplV
Definition
(GenBank) 50S ribosomal subunit protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
llo  Legionella longbeachae
Pathway
llo03010  Ribosome
Brite
KEGG Orthology (KO) [BR:llo00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    LLO_0491 (rplV)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:llo03011]
    LLO_0491 (rplV)
Ribosome [BR:llo03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    LLO_0491 (rplV)
  Bacteria
    LLO_0491 (rplV)
  Archaea
    LLO_0491 (rplV)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: CBJ10822
Pasteur: llo0491
UniProt: D3HPK8
Position
566282..566617
Genome map
AA seq 111 aa AA seqDB search
MEVTAKLKGAPLSAQKGRLVADMIRNMKVSGALDVLKFTPKKGAQLMLKLLESAIANAEN
NNGADIDDLKVGMVCVDEAMTLKRISPRAKGRANRICKRTCHITIKVSDEE
NT seq 336 nt NT seq  +upstreamnt  +downstreamnt
atggaagttacagctaaattgaaaggtgctcccttatccgctcaaaagggcagattggta
gcagacatgatacgaaatatgaaagtatctggtgcgcttgatgtcctcaagtttacacca
aaaaaaggtgctcaattaatgcttaagttgttggaatcagctatagccaatgctgaaaat
aataacggggcagatattgatgatttaaaagtgggtatggtctgcgttgatgaagcaatg
acattaaaacgcattagtcccagagctaaaggacgtgcaaacagaatttgcaaacgtacc
tgccatatcacgattaaagtatctgacgaggaatag

DBGET integrated database retrieval system