KEGG   Legionella longbeachae: LLO_1816Help
Entry
LLO_1816          CDS       T01183                                 

Gene name
yfcX
Definition
(GenBank) enoyl CoA hydratase
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
llo  Legionella longbeachae
Pathway
llo00071  Fatty acid degradation
llo00280  Valine, leucine and isoleucine degradation
llo00281  Geraniol degradation
llo00310  Lysine degradation
llo00362  Benzoate degradation
llo00380  Tryptophan metabolism
llo00410  beta-Alanine metabolism
llo00640  Propanoate metabolism
llo00650  Butanoate metabolism
llo00903  Limonene and pinene degradation
llo00930  Caprolactam degradation
llo01040  Biosynthesis of unsaturated fatty acids
llo01100  Metabolic pathways
llo01110  Biosynthesis of secondary metabolites
llo01120  Microbial metabolism in diverse environments
llo01130  Biosynthesis of antibiotics
llo01200  Carbon metabolism
llo01212  Fatty acid metabolism
Module
llo_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:llo00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    LLO_1816 (yfcX)
   00650 Butanoate metabolism
    LLO_1816 (yfcX)
  Lipid metabolism
   00071 Fatty acid degradation
    LLO_1816 (yfcX)
   01040 Biosynthesis of unsaturated fatty acids
    LLO_1816 (yfcX)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    LLO_1816 (yfcX)
   00310 Lysine degradation
    LLO_1816 (yfcX)
   00380 Tryptophan metabolism
    LLO_1816 (yfcX)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    LLO_1816 (yfcX)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    LLO_1816 (yfcX)
   00281 Geraniol degradation
    LLO_1816 (yfcX)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    LLO_1816 (yfcX)
   00930 Caprolactam degradation
    LLO_1816 (yfcX)
Enzymes [BR:llo01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     LLO_1816 (yfcX)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     LLO_1816 (yfcX)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     LLO_1816 (yfcX)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 NAD_binding_2 Pyr_redox_2
Motif
Other DBs
NCBI-ProteinID: CBJ12193
Pasteur: llo1816
UniProt: D3HTF1
Position
complement(2144021..2146039)
Genome map
AA seq 672 aa AA seqDB search
MNNYKHWELHQDNDNILWLGLNRIDTTVNSINEEVLDELNSLLHEISQNKNAIGLIVYSA
KEKGFIAGADVNAFSKFETTAQAVDFLRKGQAVFARLQALTVPSVAMIDGFCMGGGCELA
LACTYRVASDEKDTRIGLPEVMLGIHPGWGGTVRLPQLIGGFNALSQIILTGSAVSASRA
KSLGMVDDVVPVRQLKRAAIYFIKNKPAKHKPSLIQGITNNAWVRKPLASLMRRSVGKRV
RKEHYPAPYAIIDLWEHEGGIGDRAYLKEIDSIEHLISTGITSKNLIRAFTLRERLKAFA
KGSDFKAKQVHVIGAGVMGGDIAAWCALRGLKVTLQDQTYAQIAPAIGRAHALYKKKLRK
PRLIQAAMDNLIPDPEGCGIARADVIIEAVFENLAVKQDIIKKVEKFAKKDAIIATNTSS
IPLDEMSSVMNDPKRLVGIHFFNPVAKMDLVEIVSSAQTSKKVELNSCAFVNQIGKLPLP
VKSSPGFLVNRVLMPYLMECVQLLDEGYSPETIDEAALAFGMFMGPVELADTVGLDVGLA
VAENLTGHFGGTVPQKLRDMVKEGKLGRKSGQGFYHYKNGKAIKKRPTVAIDAHIADRLI
LRMVNESAACLREGVVADADLLDAGMIFATGFAPFRGGPMNYAKDFGANNLEKLFKTLES
KYGERFKVDESL
NT seq 2019 nt NT seq  +upstreamnt  +downstreamnt
atgaataattataaacattgggaattgcatcaagacaatgacaatattctatggctgggt
ttaaacagaatagatacaactgtaaatagcattaatgaagaagtattggatgaactgaat
agtttgcttcatgaaatttcacaaaataaaaatgctataggattaattgtgtattcagct
aaagaaaaaggatttattgctggtgcagatgttaatgctttttctaaattcgaaacaacg
gctcaagcggtagatttcttacgaaaaggacaagccgtatttgctaggttacaggcatta
acagttcctagtgttgccatgattgatggcttttgtatgggaggaggttgtgaattagct
ttagcctgtacctaccgtgtcgcgagtgatgaaaaagatactcggattggtttgcctgag
gtaatgctaggtatacatcctggttggggcggtactgtgcgtttgccgcaactcatagga
ggttttaacgccttatcacaaattattttaacgggaagtgcagtttcggcttcaagagca
aaaagcttaggtatggttgatgatgtagtacctgttcggcagttaaaacgtgcagcaatt
tatttcatcaaaaacaaacccgcgaagcataaaccctcattaatacagggaattactaac
aatgcatgggtgagaaagcctcttgcttctttaatgcgccgtagtgttggtaaacgagtt
cgtaaagagcattacccagcgccatacgccattatcgatttatgggagcatgaaggaggt
ataggggatagggcttacttaaaagaaattgactctatagaacatttgatatcgactggg
attacttcaaaaaatctaatccgggcatttactttacgtgagcgattgaaggcttttgct
aaaggaagcgattttaaggcgaagcaggtacatgttattggagcaggagtgatgggaggt
gatatagccgcctggtgtgccttgcgcgggcttaaagtaacattacaagatcaaacatat
gctcaaattgcccctgcaattgggcgtgcacatgctttatataagaaaaaattgcgcaaa
cctaggctaattcaagctgcaatggacaatttaattcctgatcctgaaggctgtggtatc
gctcgtgctgatgtaattattgaagcagttttcgagaatcttgcagtcaaacaagacatt
ataaaaaaagtcgaaaaatttgctaaaaaagatgccattattgctacgaatacatcgagc
attccattagatgagatgagcagtgtcatgaatgatcctaaacgtttagtggggatccat
tttttcaatccagtagcaaagatggatttggtcgaaattgtaagcagtgcacaaacatct
aaaaaagttgagctaaattcttgtgcatttgtcaatcaaatcggcaagcttcctttacct
gttaaatccagtccaggtttcttggtgaatcgagtattaatgccgtatttgatggagtgt
gttcaattattagatgagggctatagtcctgaaacaattgatgaagcagctttagccttt
ggtatgtttatggggccagttgaattggcagatacggtgggtttagatgtcggcttggct
gtggctgaaaatttaacaggacatttcggcggtacagtcccccagaaactacgtgatatg
gtcaaagaaggaaaactgggtcgcaagagtggtcagggtttttatcactataaaaatggc
aaagcaattaaaaagcgtccaactgttgccatagatgcccatattgcggatcgattaatt
ttaaggatggtaaatgagtcagctgcttgtttacgtgaaggagttgttgctgatgctgac
ttacttgatgcaggcatgattttcgctaccggctttgcaccatttcgtggagggccaatg
aattacgcgaaagattttggggcaaacaacttagaaaaactatttaagactttggaatca
aaatatggtgaacgtttcaaggtagatgagagtttataa

DBGET integrated database retrieval system