KEGG   Legionella longbeachae: LLO_1817Help
Entry
LLO_1817          CDS       T01183                                 

Gene name
yfcY
Definition
(GenBank) beta-ketoacyl-CoA thiolase, anaerobic, subunit
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
llo  Legionella longbeachae
Pathway
llo00071  Fatty acid degradation
llo00072  Synthesis and degradation of ketone bodies
llo00280  Valine, leucine and isoleucine degradation
llo00310  Lysine degradation
llo00362  Benzoate degradation
llo00380  Tryptophan metabolism
llo00620  Pyruvate metabolism
llo00630  Glyoxylate and dicarboxylate metabolism
llo00640  Propanoate metabolism
llo00650  Butanoate metabolism
llo00900  Terpenoid backbone biosynthesis
llo01100  Metabolic pathways
llo01110  Biosynthesis of secondary metabolites
llo01120  Microbial metabolism in diverse environments
llo01130  Biosynthesis of antibiotics
llo01200  Carbon metabolism
llo01212  Fatty acid metabolism
llo02020  Two-component system
Brite
KEGG Orthology (KO) [BR:llo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    LLO_1817 (yfcY)
   00630 Glyoxylate and dicarboxylate metabolism
    LLO_1817 (yfcY)
   00640 Propanoate metabolism
    LLO_1817 (yfcY)
   00650 Butanoate metabolism
    LLO_1817 (yfcY)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    LLO_1817 (yfcY)
   00072 Synthesis and degradation of ketone bodies
    LLO_1817 (yfcY)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    LLO_1817 (yfcY)
   00310 Lysine degradation
    LLO_1817 (yfcY)
   00380 Tryptophan metabolism
    LLO_1817 (yfcY)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    LLO_1817 (yfcY)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    LLO_1817 (yfcY)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    LLO_1817 (yfcY)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:llo04147]
    LLO_1817 (yfcY)
Enzymes [BR:llo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     LLO_1817 (yfcY)
Exosome [BR:llo04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   LLO_1817 (yfcY)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: CBJ12194
Pasteur: llo1817
UniProt: D3HTF2
Position
complement(2146032..2147351)
Genome map
AA seq 439 aa AA seqDB search
MKQQSNLNGRDVYVVDGNRTPFLKAKGIGPFSGSDLAVAAGITLLNRQPFSPSELDEVII
GSAMPGPDEANIARVIALRLGCGDKVPAFTVMRNCASGMQALDNAAMQIASGRSNLVLAG
GTDAMSHAPLLFNQKMASWLASWYSSKSIGQKLGLVTQFRPAFLAPVIALLRGLTDPIVG
MNMGQTAEKVAYRFGITREQMDEFACQSHIRLAHAYNENKMTEVSPIIDYKGRVYVQDDG
LRADSTVEKLAKLRPFFDKKYGMVTAGNSSQITDGACLLLLASSEAVKKYGLPVIGRIVD
SQWSALDPSQMGLGPVHAATPILQRQKLKPNDMDCWEINEAFAAQVLGCIEAWNNDDYCR
NQLGLEKAWGGPSLDKLNREGGAIAAGHPIGASGARIVLHVLKSLEQRNESRGMASICIG
GGQGGAMYLERVTEVKGHE
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
atgaaacagcagtcaaatttaaatggtcgggatgtttatgttgttgatggaaatcgaact
ccatttcttaaagccaaaggaataggtcctttttctggatcagatttggctgtagctgca
ggtataacattattaaatcgacagcctttttctccatcagaacttgatgaagtaattatt
ggcagtgccatgcctggaccagatgaggccaatattgctcgtgtaattgcattgcgttta
ggttgcggtgataaggttcctgcgtttactgtaatgagaaactgtgcttccggcatgcaa
gccttagataatgctgcaatgcaaatagctagtggccgcagtaatttagttcttgcaggt
ggaactgatgcaatgagtcatgctcctttattatttaatcaaaaaatggcctcttggttg
gccagttggtattcttccaaaagtattgggcaaaaattaggtcttgtcactcaatttaga
cctgcatttcttgctcctgttattgcattacttcgcggacttacagatccaattgtaggc
atgaacatgggacaaacagctgaaaaggttgcttatcgatttggtatcactcgggaacaa
atggatgaatttgcttgccagagccatattagattagcccatgcatataacgaaaacaaa
atgacagaggtatcgcctattattgactacaaaggacgtgtttatgtacaagacgatggc
ttaagggctgattcaacagtagaaaaattagctaaattaagacctttttttgataaaaaa
tacggtatggtaactgcaggaaacagctctcaaataactgatggggcgtgtttattattg
cttgctagcagtgaggcagtgaaaaaatatggtttacctgttattggacgaattgtagat
tcccagtggtctgcgcttgatccttctcaaatgggtcttggtcccgttcatgcagcaacg
cctatcttacaaagacaaaaattaaaacctaatgatatggattgttgggaaataaatgaa
gcatttgctgcacaagttcttggctgtatagaagcgtggaataatgatgattactgtcgt
aaccaattaggtctagaaaaagcttggggcggaccttcattggacaagttgaatcgtgag
ggaggggcaattgcggctggacatccaataggcgcaagcggagccaggattgtattgcat
gtattaaaatcattagagcaaagaaatgagtcgcggggtatggcctctatttgtattggt
ggaggacagggtggggcaatgtatctggaaagagtgactgaggtgaaaggacatgaataa

DBGET integrated database retrieval system