KEGG   Legionella longbeachae: LLO_1837
Entry
LLO_1837          CDS       T01183                                 
Name
(GenBank) putative conjugative transfer protein TraF
  KO
K12057  conjugal transfer pilus assembly protein TraF
Organism
llo  Legionella longbeachae
Brite
KEGG Orthology (KO) [BR:llo00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:llo02044]
    LLO_1837
Secretion system [BR:llo02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   LLO_1837
SSDB
Motif
Pfam: TraF
Other DBs
NCBI-ProteinID: CBJ12215
Pasteur: llo1837
UniProt: D3HTH3
Position
complement(2168775..2169521)
AA seq 248 aa
MIKWSVVLLIVLHSLTVLAEKPVGFLWYSIEKELHPIKKTPPRGTPFNQLSYTQQDAVLH
FYTMEALHKARQTKKVEDMRVFLSLQDYWLKESSRFKQLFQKTMLAYPQYDYTVTHPTSN
LGAKITDEVRERKKEEVIHHAVKSHGLLFFYRGKSPYDQKQIPILVDFCRRFNLSMMPVS
IDGVVLPELPNSRIDQGQAERLGVRYFPALLLVKPENQQVNPIAYGLTTQDVLMERIVQV
TTQFQGEL
NT seq 747 nt   +upstreamnt  +downstreamnt
atgattaaatggagtgttgttttgttaatcgtccttcattcactgaccgtacttgctgaa
aaaccggtaggctttctttggtacagcatcgaaaaggaactccatccaataaaaaaaaca
cctcctcgcggcacaccgtttaaccagcttagttatacacagcaagatgccgtacttcat
ttttacaccatggaagcgttgcacaaagcacgccaaaccaaaaaggtggaggacatgcgt
gtttttttaagccttcaagattactggcttaaagagtcatcccgttttaagcaactgttt
caaaaaacaatgcttgcttatcctcagtatgattatacagtcactcatcctacttccaat
cttggggccaaaataaccgatgaagttcgtgaacgaaaaaaagaagaagtgattcatcat
gcagtaaaatcccatggcttattgtttttttaccgcggtaaaagtccctatgaccaaaag
caaatacctatccttgttgatttttgcaggcgttttaatctttcgatgatgcctgtgagt
atcgatggcgtagttctgccagaacttccgaactcacgaatcgaccaggggcaagcagag
cgtttgggggttcgttattttccagcgcttcttttggtcaaacccgaaaaccaacaagta
aaccctatcgcttatggattgaccactcaagatgtattaatggagcgcatcgttcaagtg
accacccaatttcaaggagagctctaa

DBGET integrated database retrieval system