KEGG   Legionella longbeachae: LLO_1845
Entry
LLO_1845          CDS       T01183                                 

Definition
(GenBank) putative conjugative transfer protein TraB
  KO
K12065  conjugal transfer pilus assembly protein TraB
Organism
llo  Legionella longbeachae
Brite
KEGG Orthology (KO) [BR:llo00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:llo02044]
    LLO_1845
Secretion system [BR:llo02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   LLO_1845
SSDB
Motif
Pfam: TrbI SRP68 DUF16 DUF3573 FlaC_arch Spc7 DUF2730 SlyX
Other DBs
NCBI-ProteinID: CBJ12223
Pasteur: llo1845
UniProt: D3HTI1
Position
complement(2176447..2177817)
AA seq 456 aa
MVNWQLNKLIKSSQMRALMVTGSCLIVIVALALLLLTQEHKKKPELSKKSVDLTGIVDES
FTEAAANNALTTQQTELESLKKQITELTQNVKAMGEEHLRQLQSQKEEIKVQLTKLASVT
QKNNESIEHPNMPDELKEAKNQQLWHHPNTYVMNTLMASGNTLADAMPRINTVSFRPKRL
LHRTHPNLYLNPTHYVPSNTSIRAVILGGADADASVNGQSKNNGVMLFKFLEDGTLPNGQ
RSRLKGCRVSANSYGDISSERAFATLYRLSCAHPGQPIIDKEVTGWVFFNGKVGIKGRPL
MRDNKVMTWAGVSGALSGIASAAQYAQSTQFIGPYGGTSMIASSQIAPFAAYGGASKAAD
TLSAYYVKRAEQYHPVIQVGSGNVVTIVFKDGFYLEPDDSMSQHAQDQAKAREETRHLIA
QEPNTPSEMNFAVPPEVLGKIDQANALSGNQIGGMQ
NT seq 1371 nt   +upstreamnt  +downstreamnt
atggttaattggcaattaaataaattaattaaaagcagtcaaatgcgtgccttaatggtc
acaggaagttgtcttattgttattgttgcgctagcccttttgttgttgacgcaagaacat
aagaaaaagccagaattatccaaaaagtcagtggacttaaccggtattgtggatgagtcc
tttacagaggcggctgcgaataatgcattaaccacccaacaaacggaattggagtcgctt
aaaaagcaaatcaccgaattaactcagaatgttaaagcgatgggcgaagaacatcttcgg
caactccaatctcaaaaagaagaaatcaaagttcaattaactaagttggcttcggtaact
caaaagaataacgagagcattgaacaccctaatatgcctgacgaattaaaagaagcgaaa
aaccaacaactttggcaccaccccaatacttatgtcatgaataccctgatggcttcaggc
aacacccttgctgatgctatgcctcggattaatacggtttcttttagaccaaaaaggctt
ctccatcgtacgcaccccaatttgtacttaaatcctactcattacgtcccatccaataca
tcaataagggcggtgattttaggcggtgctgatgccgatgcctccgttaatggccaatca
aaaaacaatggggtgatgctttttaagtttttagaagacggcacactccccaatggccaa
cgctccagacttaaaggatgtcgggttagtgccaactcttatggcgatatttccagtgaa
cgtgcctttgcgacactttatcgattgtcgtgtgcgcatccaggccaacccattatcgat
aaagaagtaacaggctgggtatttttcaatggcaaggtaggcattaagggaagaccttta
atgcgggataataaagtaatgacttgggcaggagtaagtggcgctttatccggtatcgcc
tctgctgctcaatacgctcaaagtacgcaattcattgggccatatggaggtacttcgatg
attgcctcaagtcaaattgcgccctttgctgcttatggtggtgcttctaaagccgctgat
accttgtcggcctattacgtcaaacgtgctgaacaatatcatcctgtgattcaagtgggt
tcagggaatgtggtcaccatagtctttaaagatgggttttatttagaacccgatgattcc
atgagtcagcatgcacaagaccaagccaaagcacgcgaggagacgcgtcatcttattgct
caagagcctaacaccccatccgaaatgaactttgccgtacctcctgaagttctaggaaaa
attgaccaagccaatgcattaagcggcaatcaaataggaggtatgcaatga

DBGET integrated database retrieval system