KEGG   Legionella longbeachae: LLO_1847
Entry
LLO_1847          CDS       T01183                                 

Gene name
traE
Definition
(GenBank) Type IV conjugative transfer system protein TraE
  KO
K12067  conjugal transfer pilus assembly protein TraE
Organism
llo  Legionella longbeachae
Brite
KEGG Orthology (KO) [BR:llo00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:llo02044]
    LLO_1847 (traE)
Secretion system [BR:llo02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   LLO_1847 (traE)
SSDB
Motif
Pfam: TraE Fibroin_P25
Other DBs
NCBI-ProteinID: CBJ12225
Pasteur: llo1847
UniProt: D3HTI3
Position
complement(2178519..2179088)
AA seq 189 aa
MDFKSYQSRLSQISARFNLMVCLVFGLLLSNVVLTSFIYTLWNHHRIEVTPFSGNLSYLK
SASSVDSHYLSLMTENFINERLNVSPETVDGNHKRLLSFVNHQNYPEMLRRLTREATVIK
AKNLSSTFNITHIKTDPNKLTSIVSGTLKRYVGLQALTEDRKTYRLQFHYRNSRLSILNF
SLIKESKDA
NT seq 570 nt   +upstreamnt  +downstreamnt
atggattttaaaagttatcaaagtcgcttaagccaaatctctgcacgatttaatctgatg
gtgtgtcttgtctttgggctgctcttatcaaatgtagtgttaacgagttttatttatact
ctatggaaccaccaccgtatcgaagtaacccctttttcaggaaacttaagttatctcaag
tcagcatccagtgtggacagtcattatttaagtttaatgacggaaaattttattaatgaa
cgtttgaacgttagtcctgaaacggtggatggaaatcacaaacgtttgctttcctttgtg
aaccatcaaaattatcccgagatgctaaggcgtttgacccgtgaagctacagtaattaaa
gctaagaacctgtcatcgaccttcaacatcacgcacattaaaaccgaccccaacaaactt
acatcaattgtatcgggcaccttgaaacgctatgtgggactgcaagcgttaacggaggac
cgtaaaacatatcgattgcaatttcactatcgaaacagccgcttgtccatccttaacttt
tcgctaataaaggagagcaaagatgcgtaa

DBGET integrated database retrieval system