KEGG   Legionella longbeachae: LLO_1933Help
Entry
LLO_1933          CDS       T01183                                 

Gene name
lig
Definition
(GenBank) DNA ligase
  KO
K01972  DNA ligase (NAD+) [EC:6.5.1.2]
Organism
llo  Legionella longbeachae
Pathway
llo03030  DNA replication
llo03410  Base excision repair
llo03420  Nucleotide excision repair
llo03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:llo00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    LLO_1933 (lig)
   03410 Base excision repair
    LLO_1933 (lig)
   03420 Nucleotide excision repair
    LLO_1933 (lig)
   03430 Mismatch repair
    LLO_1933 (lig)
Enzymes [BR:llo01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.2  DNA ligase (NAD+)
     LLO_1933 (lig)
DNA replication proteins [BR:llo03032]
 Prokaryotic Type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    Other elongation factors
     LLO_1933 (lig)
DNA repair and recombination proteins [BR:llo03400]
 Prokaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA ligase
     LLO_1933 (lig)
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     LLO_1933 (lig)
   MMR (mismatch exicision repair)
    DNA ligase
     LLO_1933 (lig)
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      LLO_1933 (lig)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_aden DNA_ligase_OB HHH_2 HHH_5 BRCT DNA_ligase_ZBD PTCB-BRCT HHH
Motif
Other DBs
NCBI-ProteinID: CBJ12315
Pasteur: llo1933
UniProt: D3HIT6
Position
complement(2274837..2276852)
Genome map
AA seq 671 aa AA seqDB search
MIIDEIKEQAARLKDKIRQYDYHYYVLDEPLVPDVEYDRCFRALQNLEAQHPELLTADSP
TQRVGGTPADAFAPVTHRQPMLSLSNVFSEEELQAFVKRVTEKLDEPAQQLVFTCEPKLD
GLAVNITYENGVLVYAATRGDGTTGENITANIKTIAAIPLVLRSNKPPRFIEIRGEVYMP
KSGFEQYNKKAKELGEKTFANPRNAAAGSLRQLNPAVTANRPLAIYCYGIGACEDYRLPN
THWEQLQLLKELGFKVSSESKREVGIKGCLDYYCNMLARRDQLPFEIDGVVYKVDSIALQ
QQLGFISRAPRFACAHKFPATEEITEILAVDFQVGRTGALTPVARLAPVNVAGVTVSNAT
LHNMDEITRKDIRIGDKVIIRRAGDVIPEVVSVVLEQRPADTKEICLPLKCPVCDSDVVR
EEGEAVARCIGGLFCKAQLKRMMWHFASRKAMHIEGLGSVLIEQLVDEGIVRHLPDLYRL
DVSTLANLPRMGEKSAKNLLQALEHSKKTTLSRFLYALGIREIGEASARVLAEHFGDIEA
ISNATEADLMSLEDMGPVGAANIVHFFAQTHNLQVIQHLLELGIHWPKIEKKQQNKEHPL
FGKTVVLTGTLNTLSREEAKAKLLILGAKVSGSVSAKTDYVIAGIEAGTKLDKANNLGIS
ILDEEQFLHML
NT seq 2016 nt NT seq  +upstreamnt  +downstreamnt
atgattattgatgaaataaaggaacaagcggctagactaaaagataagataagacagtat
gattatcattactatgtactggatgaacctttagtacctgatgttgagtatgatcgatgt
tttcgtgctttacaaaatttagaagcgcagcatcctgaattattgactgctgattcacca
acacaacgtgtcggaggtactcccgcagatgcttttgctcccgtaacccacagacaacct
atgttgtccttgtcaaatgttttcagtgaagaagagttacaggcatttgttaagcgagtc
actgaaaaattagatgagccagctcagcaattagtttttacgtgtgagccaaagttggat
ggtcttgctgtaaatattacttatgaaaatggagtattggtttatgcagccactcgtgga
gatgggactacaggtgaaaacattactgccaacattaaaacgattgcagcaataccttta
gttttaagaagcaataagccgcctcgttttattgaaatacgtggcgaagtatatatgcca
aaatcagggtttgagcaatacaataaaaaagccaaagaattgggtgaaaaaacctttgcg
aatccacgtaacgcagctgctggaagtttacggcaattgaatcctgcagtaacggcaaat
agaccattggcgatttattgttatggtattggcgcttgtgaagattatcgtttaccaaac
actcattgggagcaattgcaattactaaaagaacttggttttaaagtttcttctgaatca
aaaagggaagtgggaattaaaggttgtttggattattactgcaacatgctcgccaggcgt
gaccaacttccttttgaaatcgatggtgttgtgtataaagtggatagtattgctttacaa
cagcaattgggttttatttcccgagcccctcgttttgcttgcgcacataaatttccagct
accgaagaaataacagagattttagccgttgattttcaagttgggagaaccggggcttta
acgcccgtggctcgtttagcgccagtaaatgttgctggggttacggtgagtaatgccacg
ctgcataatatggatgaaattaccagaaaagatattagaataggggataaagtgattatc
cgtcgcgctggcgatgtcattcctgaggtggtttcagttgttttagaacaacgacccgca
gatactaaggaaatttgtttacctctgaaatgccctgtttgtgattctgatgtcgttcgt
gaagaaggtgaagcggttgcccggtgtattggtggtttgttttgcaaagcccaattaaaa
agaatgatgtggcattttgcctcacgtaaggcaatgcatattgaaggattaggttcggtt
ttaatagaacaattggttgatgaaggtattgtacggcatctccctgatctttatcggctt
gacgtttctacattggcaaatcttccgcgtatgggtgagaagtctgcaaaaaacttatta
caagccttagaacatagcaaaaagaccacattaagtcgttttctttatgctttaggaatt
cgcgaaattggtgaggcaagtgctcgggtgttagcagagcattttggagatattgaagca
atttcaaatgcaacagaagcagatctcatgagtttggaggatatggggcctgttggcgct
gcaaatatagtccatttttttgcacaaactcacaacctgcaagtgattcaacatttgtta
gaacttggaattcattggccaaaaattgagaaaaaacagcaaaataaggagcacccttta
tttggaaaaactgtggtactcactggaactttaaatacactgagtcgagaagaggctaaa
gcgaaattactcatcttgggtgccaaagtaagtggtagcgtatcggcaaaaacagattat
gtgattgctggcattgaagcagggacaaagcttgataaagcaaataatttagggatttct
atcttggatgaagaacaatttcttcatatgttataa

DBGET integrated database retrieval system