KEGG   Legionella longbeachae: LLO_2198Help
Entry
LLO_2198          CDS       T01183                                 

Definition
(GenBank) putative thymidine/pyrimidine-nucleoside phosphorylase
  KO
K00758  thymidine phosphorylase [EC:2.4.2.4]
Organism
llo  Legionella longbeachae
Pathway
llo00240  Pyrimidine metabolism
llo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:llo00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    LLO_2198
Enzymes [BR:llo01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     LLO_2198
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glycos_trans_3N PYNP_C Glycos_transf_3
Motif
Other DBs
NCBI-ProteinID: CBJ12602
Pasteur: llo2198
UniProt: D3HJK8
Position
2561869..2563389
Genome map
AA seq 506 aa AA seqDB search
MNKPKKSNKLKLVKLGIDTKQEFILFIRSDCFICISEGFETQARVIVRLNKKSIIATMNI
IHSEILQDSEASLSESAWEQLNAKEGEYINISHLLPVKSIDYVRSKIYGNTLTAPQFYEI
ISDIVAGKYSDIHLSSFITACGHDNLSIDEIIYLTQSMVNTGEQLHWNHPIILDKHSVGG
IPGNRTTPIVVAIVAAAGLIIPKTSSRAITSPAGTVDTIETMTAVNLPLSKIRKIVAREG
GCMVWGGALGLSPADDIIIRVERVLDIDPMGQMIASVLSKKIAVGATHVLIDVPVGPTAK
IRSELEFFKYQNYFSLVGKALNLQVITLKTNGNQPLGIGIGPALEAKDILSVLHNNKDAP
IDLKNKAITLAAILLELGKKISHQEATELAVKLLESGTALKKFLAICEAQGGFKIPSTAS
FTRDIIATQNGLITEIDNRNLAKIAKLAGAPYEPAAGIEFYAKLNTQIEKGQLLYRVHAE
SKGILDYACTYASSIPNIIKITPKQT
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
atgaataagcccaagaaatccaataagttaaagttagttaaattagggattgatacaaaa
caggaatttattctttttatacgttcagactgttttatttgtatttcagagggttttgaa
acacaggctcgagttatcgttcggttaaataaaaaatcgatcattgcaaccatgaatatt
attcactctgagatattgcaagactccgaagccagtctttccgaaagtgcctgggaacaa
ctcaacgccaaagaaggtgaatatattaatatctctcacctgcttcccgttaagtctata
gactacgtacgctctaaaatatatggtaatacattaaccgcacctcagttttatgaaatt
atcagtgacatagtagcaggtaaatattccgatattcatttatcaagttttattactgct
tgtggtcatgacaacctaagcattgacgaaattatttaccttacccaatctatggtaaat
acaggcgagcaattgcattggaaccatccaattatccttgataaacacagcgttggtggt
attccaggcaatagaactactcctattgttgtagcaattgtggctgcagctggcctcatt
attcccaaaacttcatcacgggcaatcacatctcctgcaggaactgttgatacgatagaa
acgatgaccgcagtaaatctacctctttctaaaatccgcaagatagttgcacgtgaaggt
ggttgcatggtttggggaggggcattaggtttaagtccagcagatgatattattattcga
gtagaaagggtgctggatattgaccccatgggacaaatgatagcttccgttctttctaaa
aaaattgcagtgggcgcaacacatgtgcttatagatgtacccgttgggccaacagcaaaa
attcgttccgaacttgaatttttcaaatatcaaaattatttttctctagtaggtaaagcc
ctcaacctccaggttattactttaaaaacaaatggcaaccaacctcttggcataggtatt
ggccctgcattagaagcaaaagatattttgtccgtgctacataataataaagatgcccct
atcgatttaaaaaataaagccattacacttgctgccatcttgcttgaattgggaaaaaaa
atatcgcatcaggaggctacagagttagcagtaaaattactggaaagtggcactgctcta
aaaaagtttctggcaatttgcgaagctcaaggtggttttaaaatcccctctactgcatca
tttacacgggatattattgcgacacaaaatgggcttattaccgaaattgataatagaaat
ctagctaaaattgcaaaattggcaggagctccttatgagcctgccgcaggcattgaattt
tatgcaaaattaaatactcaaatagaaaaaggacaattgttgtatcgcgtgcatgctgaa
tctaaagggattttagattatgcctgtacttatgcttcatctatacccaacattattaaa
atcacacccaaacaaacatag

DBGET integrated database retrieval system