KEGG   Legionella longbeachae: LLO_2332Help
Entry
LLO_2332          CDS       T01183                                 

Definition
(GenBank) putative aldehyde dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
llo  Legionella longbeachae
Pathway
llo00010  Glycolysis / Gluconeogenesis
llo00053  Ascorbate and aldarate metabolism
llo00071  Fatty acid degradation
llo00280  Valine, leucine and isoleucine degradation
llo00310  Lysine degradation
llo00330  Arginine and proline metabolism
llo00340  Histidine metabolism
llo00380  Tryptophan metabolism
llo00410  beta-Alanine metabolism
llo00561  Glycerolipid metabolism
llo00620  Pyruvate metabolism
llo00625  Chloroalkane and chloroalkene degradation
llo00903  Limonene and pinene degradation
llo01100  Metabolic pathways
llo01110  Biosynthesis of secondary metabolites
llo01120  Microbial metabolism in diverse environments
llo01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:llo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LLO_2332
   00053 Ascorbate and aldarate metabolism
    LLO_2332
   00620 Pyruvate metabolism
    LLO_2332
  09103 Lipid metabolism
   00071 Fatty acid degradation
    LLO_2332
   00561 Glycerolipid metabolism
    LLO_2332
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    LLO_2332
   00310 Lysine degradation
    LLO_2332
   00330 Arginine and proline metabolism
    LLO_2332
   00340 Histidine metabolism
    LLO_2332
   00380 Tryptophan metabolism
    LLO_2332
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    LLO_2332
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    LLO_2332
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    LLO_2332
Enzymes [BR:llo01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     LLO_2332
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh LuxC ETF
Motif
Other DBs
NCBI-ProteinID: CBJ12744
Pasteur: llo2332
UniProt: D3HJY9
Position
complement(2738980..2740500)
Genome map
AA seq 506 aa AA seqDB search
MDILKHLKIHAVNPGAFSGQGWQSKVHEHQLVSFNPTNGEKLAEVATCTMEDYEEVMKRA
QYAAHEWKKVPAPKRGEIIRQIGQALREHKDALGSLVSLEMGKSKQEGDGEVQEMIDIAD
FAVGQSRMLYGNSMHSERPQHRMYEQWHPYGIVGVISAFNFPVAVWSWNAFLAAICGNVT
LWKPSAKTPLCAIAVQQICNEVLSRNGCPEIFSLIIPEHHDVVETMVNDSRIPLISFTGS
TAVGKQVAAKVAARLGKTILELGGNNAIILDETADLHLAIPAIVFGAVGTAGQRCTSTRR
LFVHHSMYDYVIERLRFAYEQITIGDPLDKHNLMGPLIDKPAVEQFNKAISRIKSAGGRI
LFGGESLHQPGFFVQPTLVCDVKNHWDVVQEETFAPILYVMPYQTLDEAIALQNNVPQGL
SSAMFTQNLKNAEYFLSAWGSDCGIANINIGTSGAEIGGAFGGEKETGGGRESGSDSWKA
YMRRQTNTINWGNELPLAQGIRFDLS
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
atggatatattaaagcatttaaaaattcatgctgttaaccctggggcttttagtggtcag
ggatggcaaagcaaggttcatgaacatcagttagtttcttttaaccctacaaatggggaa
aagcttgctgaagttgcaacgtgcactatggaagattatgaagaagtaatgaagcgtgcc
caatatgcagcgcatgaatggaaaaaagttccagctccgaaacgaggagaaattatcagg
caaattggccaggctttacgtgagcataaagatgctttaggtagtttggtatcattagaa
atgggtaaatcaaagcaagagggcgatggcgaagttcaagaaatgattgatatcgctgat
tttgccgttggccaatcccgaatgttatacgggaattccatgcactcagaacggcctcag
catagaatgtatgaacaatggcatccatatggaattgttggggttatttccgccttcaat
tttccggttgctgtttggtcttggaatgcttttctagcggctatatgtggaaatgtcacg
ttatggaaaccttcggcaaaaacacctttatgtgctatagcagtacaacaaatttgtaat
gaggtattaagtcgcaatggctgtcctgagatatttagtctaataattcccgaacatcac
gatgttgtcgaaacgatggttaatgatagtcggattccacttatttcatttaccggctca
acagctgtaggaaaacaagttgctgcgaaagttgctgctcgattaggaaaaactattctt
gagctgggtggtaataatgcaattattttagatgaaacagcagatcttcatttagcgata
cctgcaatagtttttggagcagtaggcactgcaggtcaaagatgtacctcaacacgacgt
ttatttgtacatcattccatgtatgattatgttattgagcgtttacgttttgcttatgag
caaataacaattggcgatcccttggataagcacaatttaatgggaccacttattgataag
ccagctgtagaacaatttaataaagcaatatcccgtattaaatcagcgggtggccgtatt
ttatttggtggggagtcgttgcatcaaccgggattttttgtccaacctaccttggtatgt
gatgtaaaaaatcattgggatgttgtgcaagaagaaacttttgcacctattttgtacgta
atgccttatcagactttagatgaagccattgccttacaaaataatgttcctcaaggattg
tcctcagcgatgtttactcaaaatttgaaaaatgcagaatattttttaagtgcatggggc
agtgattgtggaattgccaacattaatataggtacttcaggtgctgaaattggtggagca
tttggaggagagaaagagactggtggggggcgtgaatcagggtctgactcttggaaggcg
tatatgcgtcgccaaaccaatacaattaactggggtaatgaattacctttagctcaaggg
attcgttttgatctgtcttga

DBGET integrated database retrieval system