KEGG   Legionella longbeachae: LLO_2346Help
Entry
LLO_2346          CDS       T01183                                 

Gene name
rluD
Definition
(GenBank) Ribosomal large subunit pseudouridine synthase D (Pseudouridylate synthase) (Uracil hydrolyase)
  KO
K06180  23S rRNA pseudouridine1911/1915/1917 synthase [EC:5.4.99.23]
Organism
llo  Legionella longbeachae
Brite
KEGG Orthology (KO) [BR:llo00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:llo03009]
    LLO_2346 (rluD)
Enzymes [BR:llo01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.23  23S rRNA pseudouridine1911/1915/1917 synthase
     LLO_2346 (rluD)
Ribosome biogenesis [BR:llo03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    LLO_2346 (rluD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2 S4 NepR
Motif
Other DBs
NCBI-ProteinID: CBJ12758
Pasteur: llo2346
UniProt: D3HK03
Position
2755951..2756916
Genome map
AA seq 321 aa AA seqDB search
MIEHIKKQLTIPREYHNQRIDTALAHLLSDYSRSQISNWIKCGSIMLNHQSCKPKDKVED
GDLIDINVNFNKTDTNLEHCIPEEIPLNIIYEDDDVLVLNKPANMVVHPGAGNKEHTLVN
ALLHHSPSLIHLPRAGIVHRLDKDTTGLLIIAKTLPAHTSLIRQMQAREIKRHYITLVQG
HIISGGTIDTGFGRHPRNRLKMAVQEHGRQAITHYAVKKQYHDFTLLDVNLMTGRTHQIR
VHLAYIHHPVVGDPLYGTRMRFPSQAPEHLRTLFQNFKRQALHARTLSFYHPKTEKELTL
MAPIPDDFKLLLNTLDEHYED
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgatagaacatattaaaaaacaattgaccattccacgcgagtaccataatcaacgaata
gatacggcactcgcacatctactttccgactattcacgctcacaaattagcaactggatt
aaatgtggctcaattatgcttaatcaccagtcttgtaaacccaaagataaagttgaagat
ggtgacctaatcgatatcaacgttaattttaataaaacagataccaatttagaacattgc
atcccagaagaaattcctttaaatataatttatgaagatgacgatgttctagtgcttaat
aaaccagcaaatatggttgtacatcctggcgctggaaataaagaacatacattggttaat
gcattactccatcattccccctcacttattcatttacctcgagcagggattgtccatcga
ctcgacaaagacacaaccggcctgttaatcatagcgaaaacattacccgcacatacctcc
ttgatacgccaaatgcaggctcgagaaattaaacgtcattacattactttagtacaaggc
catattatttccggcggcactattgatacaggttttggacgccaccctagaaatcgatta
aaaatggccgtacaagaacatggaaggcaagccataactcattatgcagtaaagaagcag
tatcatgactttaccttattggacgtcaacctcatgactggacgaacacaccaaatcagg
gttcatctagcatatatccatcatcctgttgttggtgatccactatatggaacacgcatg
cgctttccatcgcaagctcctgagcacttacgcaccctatttcaaaactttaaaagacaa
gccctacacgcgcgcactctttcattttatcatccaaaaacagaaaaagagttgacgctt
atggctcctatccctgatgactttaagctccttctaaacacattggacgagcattatgaa
gactaa

DBGET integrated database retrieval system