KEGG   Legionella longbeachae: LLO_2877
Entry
LLO_2877          CDS       T01183                                 
Name
(GenBank) putative conjugal transfer protein TrbC
  KO
K20528  type IV secretion system protein TrbC
Organism
llo  Legionella longbeachae
Pathway
llo02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:llo00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    LLO_2877
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:llo02044]
    LLO_2877
Secretion system [BR:llo02044]
 Type IV secretion system
  Trb secretion system protein
   LLO_2877
SSDB
Motif
Pfam: TrbC 2TM
Other DBs
NCBI-ProteinID: CBJ13316
Pasteur: llo2877
UniProt: D3HLJ6
Position
3359207..3359584
AA seq 125 aa
MNQTTLFNQKNYWIMGLIVLFLLLITHPAAASSAGGGLPFDSWLTKIQKSITGPFAFSAA
IIGLVAAGATLIFGGELNGFMRSLVFFVLVLSFLVAAQNTMTAITGKGAEISKPAVGIIA
TESQL
NT seq 378 nt   +upstreamnt  +downstreamnt
atgaatcaaacaactctatttaaccaaaagaactactggataatgggattaatcgtttta
tttttgttgttaatcactcatccagccgcagcttcctctgccggagggggacttcccttc
gattcatggctgactaaaattcaaaaatccattacaggcccttttgcctttagtgctgcc
atcatcggattggttgcagcaggagcgacgcttatttttggcggtgaattaaatggattt
atgcgatctcttgtcttttttgtgttggtgctctcatttctggtagctgctcaaaatacc
atgacagcaattactggcaaaggcgctgaaatttctaaaccagctgttggaattattgca
acggagtctcagttatga

DBGET integrated database retrieval system