KEGG   Legionella longbeachae: LLO_2888
Entry
LLO_2888          CDS       T01183                                 
Symbol
traF
Name
(GenBank) Conjugal transfer protein traF precursor
Organism
llo  Legionella longbeachae
SSDB
Motif
Pfam: Peptidase_S26 TMEM40
Other DBs
NCBI-ProteinID: CBJ13327
Pasteur: llo2888
UniProt: D3HLK7
Position
3369942..3370487
AA seq 181 aa
MKKLSVFIAFFLICLIALGALLHAMGFRINLTESIPIGLYRITSAETLKNAYVIFCPDDR
KSFRLAKNRGYIDHGLNCGGYGYLMKKVVAVSGDILSVTPEGVLVNQTLLPFSKPKLKDG
INRTLPQWRTLDYPLKENEVMTLTSQSEWSFDGRYYGLVHTRQIKGMITPIWVINKREKT
T
NT seq 546 nt   +upstreamnt  +downstreamnt
atgaaaaaattgtccgtcttcatcgcttttttcttgatatgtcttattgctttaggcgca
ctgctccatgctatgggttttaggataaacctgactgaatccatacctataggcttatat
cgcatcaccagtgcagaaactctcaaaaatgcttatgtgattttttgccctgatgacagg
aagtcgtttaggttagccaagaacagaggctatatagaccatggtcttaattgcggtgga
tatggttatttaatgaaaaaagtggtcgcggtatctggtgatattctttctgtgacacct
gaaggggtcttggtaaatcaaacgttgcttcccttttcaaagccaaagttaaaggatgga
attaaccgaacattacctcaatggaggaccttagattatccgcttaaagaaaatgaagtg
atgaccttgaccagtcaaagcgaatggtcatttgatggtcgatattatggtcttgttcac
acaagacaaatcaagggaatgatcacacccatatgggtaattaataaacgggagaaaacc
acatga

DBGET integrated database retrieval system