KEGG   Legionella longbeachae: LLO_2972Help
Entry
LLO_2972          CDS       T01183                                 

Definition
(GenBank) hypothetical protein
Organism
llo  Legionella longbeachae
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: CBJ13419
Pasteur: llo2972
UniProt: D3HLT9
Position
3452732..3452917
Genome map
AA seq 61 aa AA seqDB search
MQGIAIKNSFGFGKTVAFSCEKIREQVTNRAEKEGLGILAEIGIASKTKSKSQNLFVPCF
A
NT seq 186 nt NT seq  +upstreamnt  +downstreamnt
atgcaaggaatagcaataaaaaattcatttggttttggcaaaacagtagctttctcctgt
gagaagataagagaacaagttactaacagagctgaaaaagaaggtcttggaattctggca
gagattggtattgcttcaaaaacgaaatcgaagagtcaaaacctgtttgtcccgtgtttt
gcatga

DBGET integrated database retrieval system