KEGG   Legionella longbeachae: LLO_2975Help
Entry
LLO_2975          CDS       T01183                                 

Definition
(GenBank) putative oxydoreductase
Organism
llo  Legionella longbeachae
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_dim Pyr_redox Pyr_redox_3 NAD_binding_8 FAD_binding_3 GIDA DAO 3HCDH_N NAD_binding_7 HI0933_like TrkA_N AlaDh_PNT_C FAD_oxidored FAD_binding_2 Thi4 K_oxygenase XdhC_C UDPG_MGDP_dh_N Trp_halogenase NAD_Gly3P_dh_N 2-Hacid_dh_C Germane
Motif
Other DBs
NCBI-ProteinID: CBJ13422
Pasteur: llo2975
UniProt: D3HLU2
Position
complement(3455116..3456513)
Genome map
AA seq 465 aa AA seqDB search
MALEFDVIILGGGKGGKTLAVDLAKNGQRVAMIEDNQIGGTCINVACIPTKTLVQSAKIA
HYCRSATAYGLDAVLAPIDFKAIRARKNAVVTAMREANLKQFLDSGMDLMLGRGYFLGHK
LIEVNLSSPRDGQNKLEITADKIVINTGALPFIPPIPGLDKVNYYTNDSLMNVDEVPKHL
LIVGGGYIGLEFAQLFRRLGADVTVIEASKEFLGREDSDIAKQVLETLTQEGIHFALDTQ
IKSIHEEHEAIIVDLNQNGKSELIRGSDVLIAVGRIANTEWLNLEKTGVELDERGFIKVN
EYLETTAKGIWALGDVKGGAQFTHLSLDDYRLLKHNLQNPQSKHSAQGRLIPYTVFLDPE
LARIGMTEKQALAEGHSIKIAKIPAASIPRAKTQGETTGLLKAVIDAKTDHILGVSIFCA
EAGEILGVVQLAMELGIPYQKLRDVMFAHPTLVEGINLWFGSVAE
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atggccttggaatttgacgtaatcattttaggtggtggcaaaggtggtaaaactcttgct
gttgatttggcaaaaaatggacaacgagttgccatgattgaagataatcaaattggtggc
acgtgcattaatgtagcatgcatacctaccaaaacgttggtgcaatcggccaagattgcg
cattattgtcgttcagcgacagcctatggtttagatgctgttcttgctcctattgatttt
aaagcaattcgtgcacgcaaaaatgctgtagtcactgcaatgcgtgaagctaatttaaaa
caatttttagactccggtatggatcttatgctgggtcgagggtactttttaggccataaa
ttgattgaggtgaatttatcctcgccgcgagacggtcaaaataaattagaaattactgcg
gacaaaattgttattaatacaggggctttgccttttataccgcctatccctggcctcgat
aaagtcaactattacaccaatgacagtttaatgaatgttgatgaggtgcctaaacattta
ctgattgttggaggggggtatattggcttggagtttgcgcagttattccgtcgtttggga
gcagatgttactgttatagaagcaagtaaggaatttcttggccgtgaagatagcgatatc
gccaagcaagttttggaaaccttgactcaggagggaatccattttgcactggatactcaa
attaaaagtatccacgaggaacatgaggcgatcattgttgatttgaatcaaaatggaaaa
tcggaactaattcgtggaagtgatgtgcttattgcagttggacgtattgcaaatacagaa
tggttaaatttagaaaagacgggggttgaacttgatgaacgtggttttattaaagttaat
gaatatcttgaaactacagctaagggaatttgggctttaggtgatgtcaaggggggggct
caatttactcatttgtccctggatgattatcgtttattaaaacataacctacaaaaccca
cagagtaaacattcggctcaaggacggttgattccctatacagtatttcttgacccagag
ttagcacgaattggcatgacagaaaaacaagcccttgctgaaggtcattctataaaaata
gcaaaaatacctgctgcgagtattcctcgggcaaaaacacaaggcgaaacaacaggtctt
ttgaaagcagttattgatgcaaaaacagatcatattttaggcgtttcaattttctgtgcc
gaagcgggtgaaattcttggcgtagtacaactagccatggagctgggtataccttaccag
aaattacgtgatgttatgtttgctcatccgacattagttgaaggaattaatctttggttt
ggatcagtggcagagtga

DBGET integrated database retrieval system