KEGG   Legionella longbeachae: LLO_2986Help
Entry
LLO_2986          CDS       T01183                                 

Gene name
capP
Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
llo  Legionella longbeachae
Pathway
llo00620  Pyruvate metabolism
llo00680  Methane metabolism
llo01100  Metabolic pathways
llo01120  Microbial metabolism in diverse environments
llo01200  Carbon metabolism
Module
llo_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:llo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    LLO_2986 (capP)
  09102 Energy metabolism
   00680 Methane metabolism
    LLO_2986 (capP)
Enzymes [BR:llo01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     LLO_2986 (capP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: CBJ13433
Pasteur: llo2986
UniProt: D3HLV3
Position
3467972..3470287
Genome map
AA seq 771 aa AA seqDB search
MKQNVSHLPRELSHMVSWSLTHLGKAIAEVYGKETYEIIEQIRVSMQDTIGSKALELRKA
LLSLQIELSKLDRSRLYQIAHGFSLMMELINACESAYRISRINQRKEKIYSDKPQGIHYI
LTAHPTEARTNEFLILFKAIRDYLVEVLKSPYLMNESHLDQMLKISLQINISPHKKPSVE
DEARYIYQYALNPLNIQLYHSFYTKGVPIQLRTWVGGDKDGHSGVNEKIMVKSLELSRSF
FITYIQECLKEVLEIVKFSTGLNANKILANQINQLIRKTQDLRKIKPRDHGRVSAFKNEL
TTIQADTLKFLNFKLEQFSVIASIFQLYPALVIPLELREDSAVVKESLTSIKKTTITNML
EQVYSITHGTDPKNYIRGFILSMVESAEDIKNGIKLVKQVFRSYALPVVPLFENQLALTN
ADTILNNSITEDIKEKHLKQWDGSYEVMLGYSDSSKENGVLASRLMIAKSLKSIQSTLEN
KNLKPIFFHGSGGSIERGGGDIKEQTASWSKEIMSNYKATIQGEMVARLFGSSSILKSQI
DKLLDIYSQQDNKIDNDYPEELVLFATKVSQQYKALIKSEWFWAVIEQASPYHFLKELKI
GSRPTKRKSGSDQRKLRAIPWILCWTQTRLLFPTWWGLGSSWLELNDPGKNKLKLVYNEN
ALFASFVKQLGVTLSKVYLPIWEQYLYQLTGSNKYLKPFQSELESTILFFYQITGEKDFC
FHQPWLGESIQLRSTMVHPLNLIQIEAIKRKDLPLLRKTVTGISCGMLTTG
NT seq 2316 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaaaatgtctcccatctgccaagagaactcagccatatggtttcttggtctctt
actcatttagggaaggccattgcagaagtttatggaaaagaaacatacgaaataattgag
caaattcgagtgtctatgcaagacaccattgggagtaaagcactcgagcttagaaaggcg
ctccttagtctccagattgagctttccaagcttgatagaagtcgtctttatcaaattgcg
catgggttttctctcatgatggaactcattaatgcctgtgaaagtgcttaccgaatttct
cgtatcaaccaaagaaaagaaaaaatttattctgacaaaccgcaaggtattcattatatt
ttaacagcacacccaaccgaagctcgcaccaatgaatttttaatacttttcaaagcaatt
cgtgactatctggtcgaggtgcttaaatctccctatctgatgaatgaatcacacctggat
caaatgcttaaaatttcgctccaaattaacatttctccacataaaaagcccagcgtagaa
gacgaggctcgatacatctatcaatacgcactcaatccactcaatatccaactttatcat
tccttttacactaagggtgttcctattcaattacggacctgggtaggaggtgataaagat
gggcattcaggggttaatgaaaaaatcatggttaaaagtctcgagctttctcgatctttt
tttatcacctacattcaggagtgtttaaaagaagtactcgaaattgttaaattctcaacg
ggattaaatgcaaacaaaattttggcaaaccagatcaatcagcttatcaggaaaacccag
gaccttaggaaaataaaacccagggatcatggaagagtttctgcgttcaaaaatgagtta
actacgatccaagcggacaccctaaagtttttaaattttaaactcgaacaattctccgtt
attgccagcatttttcagctttatcctgcattggtcatacccttagagctcagagaggat
tcagccgttgtaaaagaaagtttaacaagcatcaaaaaaaccacaatcaccaatatgctt
gaacaagtttattctataacccatgggaccgatcccaaaaactatatacggggttttatt
ctcagcatggttgaatccgctgaggatataaaaaatggaattaagttagtgaaacaagtg
tttagaagctatgccttacctgttgtacccttatttgaaaatcaacttgcgctcaccaat
gcggatacgattttaaataattctatcactgaagatattaaagaaaagcatcttaagcaa
tgggatggcagctatgaagtcatgctgggttattccgattcctctaaagaaaatggcgta
ttagcttctcggctcatgattgctaaaagtttaaaaagtattcagtctacattagaaaac
aagaatcttaagcccattttttttcatggttcgggtggcagtattgagcgtggcggtggg
gatatcaaagaacaaactgcatcctggtcaaaggaaataatgtcaaattataaagcgacg
attcagggagaaatggttgcacgactttttgggtcgagctctatactcaaaagccagatt
gacaaacttcttgatatctattcacaacaagataataagatagataatgactatcctgag
gaactggtattatttgccacaaaagtcagccaacaatataaagcgctgataaagagtgaa
tggttttgggcggtaattgaacaagcatccccctatcattttttgaaggaacttaagatt
ggatctcgcccaaccaaacgaaaatcaggctcggatcaaagaaagcttcgtgctatccca
tggattctatgctggactcaaacacgactccttttcccaacctggtggggcctgggttcc
tcttggctagagctaaatgatcctggaaaaaataaacttaagcttgtttacaacgaaaat
gctctttttgcttcctttgtcaaacaattaggagtgaccctctccaaagtttatctccct
atctgggaacaatacctctatcaattgactggttccaataaatatcttaagccttttcaa
tcagagttagaatcaaccatcttattcttctaccaaataacaggtgaaaaggatttttgt
tttcatcaaccctggctaggagaaagtatccaattaagatcaaccatggttcatcctttg
aatctcattcagattgaggccataaaaagaaaagatttacctcttttaagaaaaacagtc
acaggcatctcttgtggtatgttgacaacaggataa

DBGET integrated database retrieval system