KEGG   Legionella longbeachae: LLO_2988Help
Entry
LLO_2988          CDS       T01183                                 

Definition
(GenBank) hypothetical protein
Organism
llo  Legionella longbeachae
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Baculo_19 GST_C_6
Motif
Other DBs
NCBI-ProteinID: CBJ13435
Pasteur: llo2988
UniProt: D3HLV5
Position
complement(3470954..3471280)
Genome map
AA seq 108 aa AA seqDB search
MYPPAYMLARQSTTDIHRDNLIFKRNDLIVVNIHGIHKIYQKGINDLQAIEQFIIHRQQG
KCRVIDMSLYAFLQVIQQTPLDIPIRSYVTTSEAIQSYLSSLKGEFRY
NT seq 327 nt NT seq  +upstreamnt  +downstreamnt
atgtacccgcctgcatacatgcttgctcgtcaatcgacaacagatatccaccgggataac
ttgatttttaaaaggaatgatttaatagtcgttaatattcatggtattcataaaatttat
caaaaaggcattaatgatttacaagcgattgagcaatttattattcatcgccaacaaggc
aaatgtcgggttattgatatgtcgttatatgcttttttgcaggttatccaacaaacaccc
ctggatattcctatccgttcttatgtaacgacatcagaagcgattcaaagttatttatct
tctctaaaaggtgaatttcggtattga

DBGET integrated database retrieval system