KEGG   Legionella longbeachae: LLO_2992Help
Entry
LLO_2992          CDS       T01183                                 

Gene name
nsrR
Definition
(GenBank) DNA-binding transcriptional regulator
  KO
K13771  Rrf2 family transcriptional regulator, nitric oxide-sensitive transcriptional repressor
Organism
llo  Legionella longbeachae
Brite
KEGG Orthology (KO) [BR:llo00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:llo03000]
    LLO_2992 (nsrR)
Transcription factors [BR:llo03000]
 Prokaryotic Type
  Helix-turn-helix
   Rrf2 family
    LLO_2992 (nsrR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Rrf2 HTH_27 MarR TrmB MarR_2 Cdc6_C
Motif
Other DBs
NCBI-ProteinID: CBJ13439
Pasteur: llo2992
UniProt: D3HLV9
Position
3474039..3474485
Genome map
AA seq 148 aa AA seqDB search
MQLTQFTDYSLRALIYITLRKESCTIKDITDAYTISNNHMVKIIHNLAKLGLIKTSRGKG
GGILIAVQPETINLGKLIAQLEPHFDLVPCFNKEKANCCIAPVCRLKGILHEAQTAFMKV
LERYTLADVLHNPKELSVLLNMKQINNQ
NT seq 447 nt NT seq  +upstreamnt  +downstreamnt
atgcaactcacacaatttactgattactccttgcgcgctttgatttatatcactttgaga
aaagaatcatgcacgattaaagatattactgatgcttacactatatcgaataatcatatg
gttaagataattcataacttagccaaacttgggctgattaaaaccagtcgtggaaaagga
ggtggtatcttaatagcagttcaacccgaaacaattaatttgggcaaactgattgctcaa
ctagagcctcattttgatttagtaccttgttttaataaagaaaaagcaaactgctgtatt
gcccctgtatgccgattaaaaggtattttacatgaagcccagactgcgtttatgaaggtt
ttagagcgttataccctggctgacgttttacataatccaaaggaactatctgtattattg
aatatgaaacaaattaataaccaatag

DBGET integrated database retrieval system