KEGG   Legionella longbeachae: LLO_3000Help
Entry
LLO_3000          CDS       T01183                                 

Gene name
purU
Definition
(GenBank) formyltetrahydrofolate hydrolase
  KO
K01433  formyltetrahydrofolate deformylase [EC:3.5.1.10]
Organism
llo  Legionella longbeachae
Pathway
llo00630  Glyoxylate and dicarboxylate metabolism
llo00670  One carbon pool by folate
Brite
KEGG Orthology (KO) [BR:llo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    LLO_3000 (purU)
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    LLO_3000 (purU)
Enzymes [BR:llo01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.10  formyltetrahydrofolate deformylase
     LLO_3000 (purU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Formyl_trans_N ACT
Motif
Other DBs
NCBI-ProteinID: CBJ13447
Pasteur: llo3000
UniProt: D3HLW7
Position
3485581..3486417
Genome map
AA seq 278 aa AA seqDB search
MNQYRILIQAPDRAGLVYKAAKIFYEHGLNIISNNEFVDNTNHQFFMRTVVAGEIDVSLL
YNQLIDQMPQNTLVVIKPPHKKNIVLMATKEAHVLGDILIRYQEGLLDANILGILSNHNV
LFPLCSHFNIPYYHISADNLSREEHEAQIISILNQFDSIDYIVLAKYMRILTPNFTQQYQ
GKIINIHHSFLPAFIGANPYKQAYDRGVKIIGATAHFVNENLDEGPIIEQDVIHVDHAYD
WQSMQQYGRDVEKVVLARALKLALEDRIFVYGNKTVIF
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
gtgaatcaatatcgtattttaatccaggcacctgatcgagccggtcttgtgtacaaagcc
gccaagatattttacgaacatgggctaaatatcatttctaacaatgaatttgtagataat
acaaatcatcagttttttatgcgtaccgtagtggctggtgaaatagatgtatcacttcta
tacaaccaattaatagaccaaatgcctcaaaataccctggttgtcattaaacctcctcat
aaaaaaaatattgtccttatggctacaaaagaagcccatgttttaggtgacattttaatt
cgttatcaagaagggcttcttgatgccaatattcttggtattttatcaaaccataatgtt
ttatttccattatgtagtcattttaatattccttattatcatataagtgctgacaatctc
tccagagaagaacacgaagcccaaattatcagtattctgaaccagtttgattccattgat
tatattgtgttagctaaatacatgcgtattctgacacccaattttacacaacaatatcaa
ggaaaaataatcaatatccatcattcattcttgcccgcttttataggagccaatccttac
aaacaggcttatgatcggggtgtcaagattattggagccactgcccatttcgtcaatgaa
aatctggatgaagggcctatcattgagcaagatgtaattcatgttgatcatgcttatgac
tggcaaagcatgcaacaatatggcagagatgttgaaaaagtagttttagctcgggcctta
aagcttgctttagaagatcgaatatttgtgtatggcaataaaaccgttatcttttaa

DBGET integrated database retrieval system