KEGG   Legionella longbeachae: LLO_3003Help
Entry
LLO_3003          CDS       T01183                                 

Definition
(GenBank) putative oxidoreductase, short-chain dehydrogenase/reductase family protein
Organism
llo  Legionella longbeachae
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR Epimerase Methyltransf_11 DUF4459
Motif
Other DBs
NCBI-ProteinID: CBJ13450
Pasteur: llo3003
UniProt: D3HLX0
Position
3498241..3498987
Genome map
AA seq 248 aa AA seqDB search
MFSKQIFVVTGGSTGIGQATAALLAEKGAQVYNLDINKPTHSHSLIHYVPCDISVFPEVE
KAFQNIISRENKIDLLFANAGIHLFANLEDTSVEDLDRVININLKGIYYALKCTIPVMKR
QNSGAIVLTGSDQSLIGKGESSIYGATKAAIAQLTKSTAIDYAKYNIRINCICPGTIETP
LYHTAVSAYSSKSGIPREKIYESLKLAQPISRVGTATEVANLVEFLLSEKSSFITGSLFS
IDGGFVAQ
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgttttcaaaacaaatttttgttgtaacaggtggctccacaggaattggccaggctacg
gcggctcttttagcagagaaaggggctcaagtttataatttggacataaataagcccacg
catagccattctttaattcattatgttccttgtgatatatccgtattcccagaagtagaa
aaagcattccagaatattatttcccgtgaaaataaaatcgatttattatttgcaaatgca
ggtatccatttatttgcaaatttagaagatacttcagttgaagatttggatagggtcatc
aatatcaatttgaaaggaatttattacgcccttaaatgtacaattccggttatgaaaagg
caaaatagtggtgctattgttttaactggctcggatcagtctcttattggtaaaggagaa
agctcgatctatggagcaaccaaagctgctatagctcaattgactaaaagcacagctatt
gattatgcaaaatataatattagaatcaattgcatatgcccaggaaccattgaaacaccc
ttataccacactgctgtcagtgcttactcatctaaatcggggattcccagggaaaaaatt
tatgaatcattaaaattagcacaacctatctcgcgggtgggtacggcaacagaagttgcc
aatctggtggaatttttactgtcagaaaagtcctcatttattacaggctcattattcagt
attgatggtggttttgtagcccagtaa

DBGET integrated database retrieval system