KEGG   Legionella longbeachae: LLO_3017Help
Entry
LLO_3017          CDS       T01183                                 

Definition
(GenBank) putative transcriptional regulator, LysR family
Organism
llo  Legionella longbeachae
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LysR_substrate HTH_1 MarR HTH_30 HTH_24
Motif
Other DBs
NCBI-ProteinID: CBJ13466
Pasteur: llo3017
UniProt: D3HLY2
Position
3513145..3514095
Genome map
AA seq 316 aa AA seqDB search
MNIVDMKTFLAVVEYHSTSLASKHLYASQPTISRRIKKLEQELGSQLFVNTTYGVELTQK
GRAFLPYIRQMLGIYNEMMKAEHNDRKSRPKLTINVGLNPYVSLSVFAEFINYMLALKTN
YFIVNKIVPGKDLNTSLSGGDYDLFILPYTGSCPANLTSIPLWKERVLPVVSINHPLAKR
TTPISITELAEYDAVLTTNESILRQKFNVLVAQKGISPKITAEVNTVYNCIKTVELGHSW
CLIYERLLDDKLAVVELNDFTIDIEFHAFYLKKRGEERLIWEFVEYFRQWLSQSSDLSDL
LIKTKSLSIQSQEHTK
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atgaacatagtagatatgaaaacatttcttgctgttgttgaatatcattcaacatccttg
gcatcaaaacacctgtatgcctcgcaacctaccataagcaggcgcattaaaaaattagag
caggagttaggtagccagctctttgtaaatactacctatggggttgaattgacccagaaa
gggagagcgtttcttccctacattcgccaaatgcttggtatttataatgaaatgatgaaa
gcggagcataatgaccgcaaaagcagacctaaattaacgattaatgtagggctgaacccg
tatgtttctctctcggtatttgctgaatttatcaattatatgctcgcacttaaaacaaat
tattttattgttaataaaatagttcccggtaaggatctgaatacaagcctttcaggtggc
gattatgaccttttcattttaccctatacaggtagttgtcctgccaatctaacctctata
ccactttggaaagaaagagttttacccgttgtctcgattaaccaccctttagcgaaacgt
accacccctatttctataactgaactggcagaatacgatgcagtcttaacaacaaatgag
agtatattgcgccaaaaatttaatgtcttggtcgcacaaaaaggcatttcacctaaaatt
accgcggaggtaaatacggtatataactgtatcaaaacagtcgaacttggacatagttgg
tgcttgatttatgaaagattacttgatgataaattagccgtggttgagctcaacgatttt
actatagatattgagtttcatgctttttatctaaaaaaacgtggcgaagagcgtttgatt
tgggaatttgttgaatattttagacaatggctcagtcaatcttctgatttaagtgacctt
cttatcaaaacaaaaagcttatctattcaaagccaggaacatactaaataa

DBGET integrated database retrieval system