KEGG   Legionella longbeachae: LLO_3023Help
Entry
LLO_3023          CDS       T01183                                 

Definition
(GenBank) hypothetical protein
Organism
llo  Legionella longbeachae
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2H-phosphodiest
Motif
Other DBs
NCBI-ProteinID: CBJ13472
Pasteur: llo3023
UniProt: D3HLY8
Position
3519952..3520683
Genome map
AA seq 243 aa AA seqDB search
MFDKIDSTGNYVEFPGVTIIAPIIKTSQENHFLHNIHQSLASSTLLTQYYTPLPLESYHM
TTCNLYTKNEHNLDWFKFITDRLEFFQNLCTQLKNHEFIPEVSIEAVQVGRALQLRLSLP
ESQKAVIRELAQTMGIEEGIPSFFHLTLAYCYKNISDKKLHQEIISAVEEIIAPYINRQI
KLHVPTLCYFESMLAFIPWNGTAYPFNEKQCIKKTNGFFDTNETPSSPITSENPSMCSSK
LLR
NT seq 732 nt NT seq  +upstreamnt  +downstreamnt
atgtttgataaaatagattcaacaggaaactatgtagaatttccaggtgtaacaattatt
gccccaattataaaaacgtctcaagaaaatcatttcttacataacatacatcaatctttg
gcaagctcaacattactcacgcagtattataccccattacccttggagagttatcacatg
actacgtgtaatctctataccaaaaatgagcataatctggattggtttaaatttatcacc
gataggcttgaatttttccaaaatctatgtacacaacttaagaaccatgaatttatacct
gaagtatcaattgaagctgttcaagtaggaagagccttgcagttacggttgtcattacct
gaaagccaaaaggcagtgatccgggaacttgcccaaacaatgggtattgaagagggcatc
ccctctttttttcatcttaccttagcttattgttacaaaaacattagtgacaaaaaattg
catcaagagataatctcagcagttgaggaaataattgccccatatatcaatcggcaaata
aagcttcatgtgcctacactttgttattttgaatctatgctggcattcattccgtggaat
ggcacagcttatccttttaacgaaaaacagtgcatcaaaaaaacaaacgggttctttgat
actaacgaaacgccatcatccccaattacttctgaaaacccttccatgtgtagttcaaaa
ttattacggtag

DBGET integrated database retrieval system