KEGG   Legionella longbeachae: LLO_3038Help
Entry
LLO_3038          CDS       T01183                                 

Definition
(GenBank) hypothetical protein
Organism
llo  Legionella longbeachae
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: CBJ13487
Pasteur: llo3038
UniProt: D3HM03
Position
3536670..3537146
Genome map
AA seq 158 aa AA seqDB search
MKMSKSCVILSCCIILFSISAYSTTGTVPQSESDIARIAMLEKALAPQKVDEVATLFAKA
NKDRNGAVQFMLFSNPLKNKYKDRWPYWVSGVSSPWITSYTIKKEAQSKNTWKFKITYQW
ATASGPFQPSLVQTIVVAPVPKNASSSQKYWITQFNEL
NT seq 477 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatgtcaaaatcatgcgtcatcttgagctgttgcattattttattttctatttct
gcatatagtactactgggaccgtacctcaatcagaatcagacatagcacgaattgccatg
ttggaaaaggcattagccccccaaaaagtagatgaagttgcaactttatttgcaaaagcc
aataaagatcgcaatggtgctgtacaatttatgttgttttctaatccattaaaaaacaaa
tataaggatcgatggccgtattgggtttctggtgtttccagtccatggattacttcttat
acaataaaaaaagaagcacaaagcaaaaatacctggaaatttaaaataacctatcaatgg
gcaactgcctctggtccatttcagccctctttagtacagaccattgtagtggctcccgtt
cctaaaaatgcaagttcgtcgcaaaaatattggattactcaatttaatgaactttaa

DBGET integrated database retrieval system