KEGG   Legionella longbeachae: LLO_3052Help
Entry
LLO_3052          CDS       T01183                                 

Definition
(GenBank) hypothetical protein
  KO
K09137  uncharacterized protein
Organism
llo  Legionella longbeachae
Brite
KEGG Orthology (KO) [BR:llo00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    LLO_3052
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF190
Motif
Other DBs
NCBI-ProteinID: CBJ13502
Pasteur: llo3052
UniProt: D3HM16
Position
complement(3549566..3549898)
Genome map
AA seq 110 aa AA seqDB search
MNHVKISVYINERDKWQHRPLHLELLNMLDENGIAGGTVLRGVAGFTFKAPIVSTSLVDI
GSKLPLVVHFVDSIEKAELVLPKIKEMAKGRLITREIVEVISGAHFDIKE
NT seq 333 nt NT seq  +upstreamnt  +downstreamnt
atgaaccatgtaaaaatttctgtctacattaatgaaagggataaatggcagcatcgcccc
ttacatcttgaattattaaatatgcttgatgaaaatggaattgcaggtggaacggtattg
cgtggggtagctggatttacgtttaaggctcctattgtatctacatcgttagttgatatt
ggaagcaagctccctttagtagtgcatttcgtagattcaatcgaaaaagcagaattggta
ttacctaaaatcaaagaaatggctaaaggtcgacttattactcgtgaaattgttgaagtg
attagtggtgcacattttgatataaaagagtag

DBGET integrated database retrieval system