KEGG   Legionella longbeachae: LLO_3055Help
Entry
LLO_3055          CDS       T01183                                 

Gene name
eamA
Definition
(GenBank) cysteine and O-acetyl-L-serine efflux system
  KO
K15268  O-acetylserine/cysteine efflux transporter
Organism
llo  Legionella longbeachae
Brite
KEGG Orthology (KO) [BR:llo00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:llo02000]
    LLO_3055 (eamA)
Transporters [BR:llo02000]
 Other Transporters
  Electrochemical potential-driven transporters [TC:2]
   LLO_3055 (eamA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: EamA CRT-like
Motif
Other DBs
NCBI-ProteinID: CBJ13505
Pasteur: llo3055
UniProt: D3HM19
Position
complement(3551236..3552129)
Genome map
AA seq 297 aa AA seqDB search
MPLTHLLLALLVVLIWGVNFLFVSFSLEEISPLLLCALRFLLSSVPAIFFVKLPSSSFKI
IALYGFIMFALQFAFLFIGMNAGMPAGMASLLMQTQVFFSMFFAIIFLGEQPNIAQIIGA
LVAFTGIGLVAMHFDSDISVVGFLCIIAAAATWGFGNFITKKIKGNGNYMMAIIAWGSFI
ACIPMFLLSWVFEGPSSFLYTYENLSWRGTVSLFYIVFASTWIGYGVWNWLIARYPVGVV
APFTLLVPIVAIVSSVVVLGEPFQLWKLAAGLLVIGGLCISILGSRLIVPKQQSGIA
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgcctcttacacatctgttattagctctcttagtcgttttaatttggggtgtaaatttt
ctttttgtttcctttagccttgaagaaatttcaccattgctgttgtgtgccttgcgtttt
ttattgtcgagtgtacctgctatattttttgtcaaattacctagttcttcttttaaaatt
attgccttgtatggttttataatgtttgctttacaatttgcatttctgtttattgggatg
aatgcagggatgccagcaggtatggcgtctttactcatgcaaactcaggtttttttcagt
atgttttttgcgataatttttttaggtgaacaaccgaatatagcgcaaattataggcgca
ttggttgcttttactggcattggtttggtagccatgcattttgatagtgatatctctgta
gtcggatttctttgtattattgccgctgcagcaacatgggggtttggtaatttcattact
aaaaaaattaaagggaacggtaattatatgatggctattatcgcatggggtagttttatt
gcttgcatcccgatgtttcttctctcttgggtatttgaagggccctccagtttcctctat
acctacgaaaatttgagttggcgaggaacagtttcattgttttatatcgtctttgcttca
acatggataggttatggggtatggaattggttaattgcccgatatccagtaggagtggtt
gcaccttttactttgttggtccctattgttgcgattgtaagttctgttgtggtactgggt
gagccatttcaactttggaagttagctgccggattgttggttattggtggtttgtgcatc
agtatacttggatctcgtttaatagtccctaagcagcaatctggaatagcgtga

DBGET integrated database retrieval system